Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M3B_RS02550 | Genome accession | NZ_AP014596 |
| Coordinates | 485939..486121 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain M3-b | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 440539..486121 | 485939..486121 | within | 0 |
Gene organization within MGE regions
Location: 440539..486121
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3B_RS02290 (M3B_0463) | fsa | 440539..441183 (+) | 645 | WP_002983569.1 | fructose-6-phosphate aldolase | - |
| M3B_RS02295 (M3B_0464) | tkt | 441401..443386 (+) | 1986 | WP_011054904.1 | transketolase | - |
| M3B_RS02300 (M3B_0465) | - | 443579..443803 (+) | 225 | WP_011054903.1 | bacteriocin immunity protein | - |
| M3B_RS02305 (M3B_0466) | - | 443879..444613 (+) | 735 | WP_011054902.1 | ABC transporter ATP-binding protein | - |
| M3B_RS02310 (M3B_0467) | - | 444618..446246 (+) | 1629 | WP_011054901.1 | ABC transporter permease | - |
| M3B_RS02315 (M3B_0468) | - | 446389..447477 (-) | 1089 | WP_011054900.1 | site-specific integrase | - |
| M3B_RS02320 (M3B_0469) | - | 447653..448204 (-) | 552 | WP_011054899.1 | hypothetical protein | - |
| M3B_RS02325 (M3B_0470) | - | 448215..448598 (-) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M3B_RS02330 (M3B_0471) | - | 448612..448962 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS02335 (M3B_0472) | - | 449601..449792 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| M3B_RS02340 (M3B_0473) | - | 449843..450043 (+) | 201 | WP_011184050.1 | hypothetical protein | - |
| M3B_RS02345 (M3B_0474) | - | 450131..450388 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| M3B_RS02350 (M3B_0475) | - | 450417..450587 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| M3B_RS02355 (M3B_0476) | - | 450580..450787 (+) | 208 | Protein_416 | hypothetical protein | - |
| M3B_RS02360 (M3B_0477) | - | 450784..451167 (+) | 384 | WP_011054892.1 | hypothetical protein | - |
| M3B_RS02365 (M3B_0479) | - | 451313..451516 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| M3B_RS02370 (M3B_0480) | - | 451604..451903 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| M3B_RS02375 (M3B_0481) | - | 451903..453060 (+) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| M3B_RS02380 (M3B_0482) | - | 453074..453637 (+) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| M3B_RS02385 (M3B_0483) | - | 453680..455602 (+) | 1923 | WP_011054887.1 | DNA polymerase | - |
| M3B_RS02390 (M3B_0484) | - | 455607..457991 (+) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| M3B_RS02395 (M3B_0485) | - | 458357..458632 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| M3B_RS02400 (M3B_0486) | - | 458629..459951 (+) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| M3B_RS09980 (M3B_0487) | - | 459952..460122 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| M3B_RS02405 (M3B_0488) | - | 460115..460387 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| M3B_RS02410 (M3B_0490) | - | 460520..460936 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| M3B_RS02415 (M3B_0491) | - | 461026..461478 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| M3B_RS02420 (M3B_0492) | - | 461468..462745 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| M3B_RS02425 (M3B_0493) | - | 462761..464293 (+) | 1533 | WP_011106638.1 | phage portal protein | - |
| M3B_RS02430 (M3B_0494) | - | 464253..465701 (+) | 1449 | WP_011054877.1 | minor capsid protein | - |
| M3B_RS02435 | - | 465729..465917 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| M3B_RS02440 (M3B_0496) | - | 465922..466188 (+) | 267 | WP_011054875.1 | hypothetical protein | - |
| M3B_RS02445 (M3B_0497) | - | 466356..466925 (+) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| M3B_RS02450 (M3B_0498) | - | 466938..467825 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| M3B_RS02455 (M3B_0499) | - | 467837..468193 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| M3B_RS02460 (M3B_0500) | - | 468204..468482 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| M3B_RS02465 | - | 468479..468823 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M3B_RS02470 (M3B_0502) | - | 468827..469186 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| M3B_RS02475 (M3B_0503) | - | 469198..469797 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| M3B_RS02480 (M3B_0504) | - | 469851..470306 (+) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| M3B_RS02485 (M3B_0505) | - | 470381..470614 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| M3B_RS02490 (M3B_0507) | - | 470629..475011 (+) | 4383 | WP_011054866.1 | tape measure protein | - |
| M3B_RS02495 (M3B_0508) | - | 475023..475865 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| M3B_RS02500 (M3B_0509) | - | 475875..477854 (+) | 1980 | WP_011054864.1 | phage tail protein | - |
| M3B_RS02505 (M3B_0511) | - | 477851..478857 (+) | 1007 | Protein_447 | hyaluronoglucosaminidase | - |
| M3B_RS02510 (M3B_0512) | - | 478867..480882 (+) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| M3B_RS02515 (M3B_0513) | - | 480894..481331 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| M3B_RS02520 (M3B_0514) | - | 481328..481945 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| M3B_RS02525 (M3B_0515) | - | 481955..482227 (+) | 273 | WP_002986916.1 | hypothetical protein | - |
| M3B_RS02530 (M3B_0516) | - | 482224..482451 (+) | 228 | WP_003058873.1 | phage holin | - |
| M3B_RS02535 (M3B_0517) | - | 482567..483769 (+) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| M3B_RS02540 (M3B_0518) | - | 484091..484606 (+) | 516 | WP_023077389.1 | hypothetical protein | - |
| M3B_RS02545 (M3B_0519) | - | 484720..485706 (-) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| M3B_RS02550 (M3B_0520) | prx | 485939..486121 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=66093 M3B_RS02550 WP_011054856.1 485939..486121(+) (prx) [Streptococcus pyogenes strain M3-b]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=66093 M3B_RS02550 WP_011054856.1 485939..486121(+) (prx) [Streptococcus pyogenes strain M3-b]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |