Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYJRS4_RS06010 | Genome accession | NZ_AP012335 |
| Coordinates | 1219726..1219908 (-) | Length | 60 a.a. |
| NCBI ID | WP_011018104.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes JRS4 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1219726..1261219 | 1219726..1219908 | within | 0 |
Gene organization within MGE regions
Location: 1219726..1261219
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYJRS4_RS06010 (SPYJRS4_1266) | prx | 1219726..1219908 (-) | 183 | WP_011018104.1 | hypothetical protein | Regulator |
| SPYJRS4_RS06015 (SPYJRS4_1267) | sda | 1220148..1221146 (+) | 999 | WP_032463908.1 | streptodornase A | - |
| SPYJRS4_RS06020 (SPYJRS4_1268) | - | 1221287..1221880 (-) | 594 | WP_003051628.1 | GNAT family N-acetyltransferase | - |
| SPYJRS4_RS06025 (SPYJRS4_1269) | - | 1221880..1222044 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| SPYJRS4_RS06030 (SPYJRS4_1270) | - | 1222193..1223398 (-) | 1206 | WP_023078214.1 | glucosaminidase domain-containing protein | - |
| SPYJRS4_RS06035 (SPYJRS4_1272) | - | 1223511..1223696 (-) | 186 | WP_011184796.1 | holin | - |
| SPYJRS4_RS06040 (SPYJRS4_1273) | - | 1223693..1223992 (-) | 300 | WP_011184797.1 | hypothetical protein | - |
| SPYJRS4_RS06045 (SPYJRS4_1274) | - | 1224003..1224620 (-) | 618 | WP_011018111.1 | DUF1366 domain-containing protein | - |
| SPYJRS4_RS06050 (SPYJRS4_1275) | - | 1224623..1225051 (-) | 429 | WP_011184798.1 | DUF1617 family protein | - |
| SPYJRS4_RS06055 (SPYJRS4_1276) | - | 1225063..1227078 (-) | 2016 | WP_011184799.1 | gp58-like family protein | - |
| SPYJRS4_RS06060 (SPYJRS4_1277) | - | 1227093..1228205 (-) | 1113 | WP_011184800.1 | hyaluronoglucosaminidase | - |
| SPYJRS4_RS06065 (SPYJRS4_1278) | - | 1228205..1230352 (-) | 2148 | WP_023078210.1 | phage tail spike protein | - |
| SPYJRS4_RS06070 (SPYJRS4_1279) | - | 1230349..1231065 (-) | 717 | WP_011018116.1 | distal tail protein Dit | - |
| SPYJRS4_RS06075 (SPYJRS4_1280) | - | 1231062..1234322 (-) | 3261 | WP_047149499.1 | tape measure protein | - |
| SPYJRS4_RS06080 (SPYJRS4_1281) | - | 1234312..1234893 (-) | 582 | WP_011018118.1 | Gp15 family bacteriophage protein | - |
| SPYJRS4_RS06085 (SPYJRS4_1282) | - | 1234897..1235331 (-) | 435 | WP_011018119.1 | hypothetical protein | - |
| SPYJRS4_RS06090 (SPYJRS4_1283) | - | 1235375..1235836 (-) | 462 | WP_011018120.1 | hypothetical protein | - |
| SPYJRS4_RS06095 (SPYJRS4_1284) | - | 1235836..1236234 (-) | 399 | WP_011018121.1 | minor capsid protein | - |
| SPYJRS4_RS06100 (SPYJRS4_1285) | - | 1236231..1236587 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| SPYJRS4_RS06105 (SPYJRS4_1286) | - | 1236587..1236919 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| SPYJRS4_RS06110 (SPYJRS4_1287) | - | 1236909..1237325 (-) | 417 | WP_011018123.1 | hypothetical protein | - |
| SPYJRS4_RS06115 (SPYJRS4_1288) | - | 1237379..1238197 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| SPYJRS4_RS06120 (SPYJRS4_1289) | - | 1238201..1238815 (-) | 615 | WP_010922079.1 | hypothetical protein | - |
| SPYJRS4_RS06125 (SPYJRS4_1290) | - | 1238941..1239207 (-) | 267 | WP_010922078.1 | hypothetical protein | - |
| SPYJRS4_RS06130 (SPYJRS4_1291) | - | 1239294..1239521 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| SPYJRS4_RS06135 (SPYJRS4_1292) | - | 1239521..1241014 (-) | 1494 | WP_011018124.1 | phage minor capsid protein | - |
| SPYJRS4_RS06140 (SPYJRS4_1293) | - | 1241019..1242520 (-) | 1502 | Protein_1184 | phage portal protein | - |
| SPYJRS4_RS06145 (SPYJRS4_1295) | - | 1242534..1243745 (-) | 1212 | WP_011184805.1 | PBSX family phage terminase large subunit | - |
| SPYJRS4_RS06150 (SPYJRS4_1296) | - | 1243828..1244301 (-) | 474 | WP_011018127.1 | hypothetical protein | - |
| SPYJRS4_RS06155 (SPYJRS4_1297) | - | 1244352..1244729 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| SPYJRS4_RS09195 (SPYJRS4_1298) | - | 1244790..1245266 (-) | 477 | WP_174148345.1 | GNAT family N-acetyltransferase | - |
| SPYJRS4_RS06165 (SPYJRS4_1299) | - | 1245182..1245859 (-) | 678 | WP_011018129.1 | ABC transporter ATP-binding protein | - |
| SPYJRS4_RS06170 (SPYJRS4_1300) | - | 1245838..1246356 (-) | 519 | WP_011018130.1 | ParB N-terminal domain-containing protein | - |
| SPYJRS4_RS06175 (SPYJRS4_1302) | - | 1246820..1247260 (-) | 441 | WP_002990052.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPYJRS4_RS06180 (SPYJRS4_1303) | - | 1247534..1247800 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| SPYJRS4_RS06185 (SPYJRS4_1304) | - | 1247797..1248168 (-) | 372 | WP_011018132.1 | DUF1642 domain-containing protein | - |
| SPYJRS4_RS06190 (SPYJRS4_1305) | - | 1248289..1248921 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| SPYJRS4_RS06195 (SPYJRS4_1306) | - | 1248923..1249207 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| SPYJRS4_RS09505 (SPYJRS4_1307) | - | 1249204..1249374 (-) | 171 | WP_011018135.1 | hypothetical protein | - |
| SPYJRS4_RS06200 (SPYJRS4_1308) | - | 1249371..1249775 (-) | 405 | WP_011018136.1 | YopX family protein | - |
| SPYJRS4_RS06205 | - | 1249772..1250056 (-) | 285 | Protein_1198 | DUF3310 domain-containing protein | - |
| SPYJRS4_RS09740 (SPYJRS4_1310) | - | 1250050..1250301 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| SPYJRS4_RS06215 (SPYJRS4_1311) | - | 1250298..1250653 (-) | 356 | Protein_1200 | hypothetical protein | - |
| SPYJRS4_RS06220 (SPYJRS4_1313) | - | 1250650..1251090 (-) | 441 | WP_011018139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPYJRS4_RS06225 (SPYJRS4_1314) | - | 1251090..1251293 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| SPYJRS4_RS06230 (SPYJRS4_1315) | ssbA | 1251299..1251718 (-) | 420 | WP_011018140.1 | single-stranded DNA-binding protein | Machinery gene |
| SPYJRS4_RS06235 (SPYJRS4_1316) | - | 1251711..1252385 (-) | 675 | WP_011018141.1 | ERF family protein | - |
| SPYJRS4_RS06240 (SPYJRS4_1317) | - | 1252386..1252868 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPYJRS4_RS06245 (SPYJRS4_1318) | - | 1252890..1253144 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| SPYJRS4_RS06250 (SPYJRS4_1319) | - | 1253125..1253481 (-) | 357 | WP_011018144.1 | HTH domain-containing protein | - |
| SPYJRS4_RS09510 (SPYJRS4_1320) | - | 1253492..1253629 (-) | 138 | WP_011018145.1 | hypothetical protein | - |
| SPYJRS4_RS06255 (SPYJRS4_1321) | - | 1253629..1254471 (-) | 843 | WP_011018146.1 | ATP-binding protein | - |
| SPYJRS4_RS06260 (SPYJRS4_1322) | - | 1254481..1255401 (-) | 921 | WP_021340238.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SPYJRS4_RS06265 (SPYJRS4_1323) | - | 1255415..1255729 (-) | 315 | WP_021340228.1 | helix-turn-helix transcriptional regulator | - |
| SPYJRS4_RS09705 (SPYJRS4_1324) | - | 1255745..1255879 (-) | 135 | WP_021340229.1 | hypothetical protein | - |
| SPYJRS4_RS06270 (SPYJRS4_1325) | - | 1255910..1256161 (-) | 252 | WP_021340237.1 | DNA-binding protein | - |
| SPYJRS4_RS09515 (SPYJRS4_1326) | - | 1256400..1256567 (-) | 168 | WP_021340232.1 | hypothetical protein | - |
| SPYJRS4_RS06280 (SPYJRS4_1327) | - | 1256571..1257290 (-) | 720 | WP_011018149.1 | phage antirepressor KilAC domain-containing protein | - |
| SPYJRS4_RS06285 (SPYJRS4_1328) | - | 1257318..1257530 (-) | 213 | WP_023078130.1 | hypothetical protein | - |
| SPYJRS4_RS06290 (SPYJRS4_1329) | - | 1257728..1258069 (+) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| SPYJRS4_RS06295 (SPYJRS4_1330) | - | 1258053..1258439 (+) | 387 | WP_032463929.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYJRS4_RS06300 (SPYJRS4_1331) | - | 1258454..1259875 (+) | 1422 | WP_011018151.1 | DUF4041 domain-containing protein | - |
| SPYJRS4_RS06305 (SPYJRS4_1332) | - | 1260053..1261219 (+) | 1167 | WP_011018152.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6935.81 Da Isoelectric Point: 3.9417
>NTDB_id=65190 SPYJRS4_RS06010 WP_011018104.1 1219726..1219908(-) (prx) [Streptococcus pyogenes JRS4]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=65190 SPYJRS4_RS06010 WP_011018104.1 1219726..1219908(-) (prx) [Streptococcus pyogenes JRS4]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
93.023 |
71.667 |
0.667 |