Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYJRS4_RS05305 | Genome accession | NZ_AP012335 |
| Coordinates | 1085636..1085818 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes JRS4 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1085636..1121962 | 1085636..1085818 | within | 0 |
Gene organization within MGE regions
Location: 1085636..1121962
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYJRS4_RS05305 (SPYJRS4_1110) | prx | 1085636..1085818 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| SPYJRS4_RS05310 (SPYJRS4_1111) | mf2 | 1086058..1086816 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| SPYJRS4_RS05315 (SPYJRS4_1112) | speC | 1086927..1087634 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| SPYJRS4_RS05320 (SPYJRS4_1113) | - | 1087703..1088455 (-) | 753 | WP_030126404.1 | CHAP domain-containing protein | - |
| SPYJRS4_RS05325 (SPYJRS4_1115) | - | 1088573..1089028 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| SPYJRS4_RS05330 (SPYJRS4_1116) | - | 1089038..1089649 (-) | 612 | WP_011184731.1 | DUF1366 domain-containing protein | - |
| SPYJRS4_RS05335 (SPYJRS4_1117) | - | 1089652..1090080 (-) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| SPYJRS4_RS05340 (SPYJRS4_1118) | - | 1090089..1091870 (-) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| SPYJRS4_RS05345 (SPYJRS4_1119) | - | 1091885..1092994 (-) | 1110 | WP_011184734.1 | hyaluronoglucosaminidase | - |
| SPYJRS4_RS05350 (SPYJRS4_1120) | - | 1092994..1094967 (-) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| SPYJRS4_RS05355 (SPYJRS4_1121) | - | 1094949..1095644 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| SPYJRS4_RS05360 (SPYJRS4_1122) | - | 1095641..1098004 (-) | 2364 | WP_047149495.1 | hypothetical protein | - |
| SPYJRS4_RS05365 (SPYJRS4_1123) | - | 1098004..1098375 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| SPYJRS4_RS05370 (SPYJRS4_1124) | - | 1098390..1098653 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| SPYJRS4_RS05375 (SPYJRS4_1125) | - | 1098664..1099254 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| SPYJRS4_RS05380 (SPYJRS4_1126) | - | 1099270..1099605 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| SPYJRS4_RS05385 (SPYJRS4_1127) | - | 1099606..1099842 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| SPYJRS4_RS05390 (SPYJRS4_1128) | - | 1099835..1100173 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| SPYJRS4_RS05395 (SPYJRS4_1129) | - | 1100133..1100555 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SPYJRS4_RS05400 (SPYJRS4_1130) | - | 1100565..1100765 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| SPYJRS4_RS05405 (SPYJRS4_1131) | - | 1100765..1101676 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| SPYJRS4_RS05410 (SPYJRS4_1132) | - | 1101701..1102162 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| SPYJRS4_RS05415 (SPYJRS4_1133) | - | 1102243..1103658 (-) | 1416 | WP_011054685.1 | terminase | - |
| SPYJRS4_RS05420 (SPYJRS4_1134) | - | 1103740..1103955 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| SPYJRS4_RS05425 (SPYJRS4_1135) | - | 1103957..1104223 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| SPYJRS4_RS09490 (SPYJRS4_1136) | - | 1104216..1104368 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| SPYJRS4_RS05430 (SPYJRS4_1137) | - | 1104445..1104669 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| SPYJRS4_RS05435 (SPYJRS4_1138) | - | 1104675..1106168 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| SPYJRS4_RS05440 (SPYJRS4_1139) | - | 1106161..1107429 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| SPYJRS4_RS05445 (SPYJRS4_1140) | - | 1107426..1107782 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| SPYJRS4_RS05450 (SPYJRS4_1141) | - | 1107930..1108274 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| SPYJRS4_RS05455 (SPYJRS4_1142) | - | 1108382..1108801 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| SPYJRS4_RS05460 (SPYJRS4_1143) | - | 1108877..1109128 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| SPYJRS4_RS09495 (SPYJRS4_1144) | - | 1109125..1109280 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| SPYJRS4_RS05465 (SPYJRS4_1145) | - | 1109277..1109594 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| SPYJRS4_RS05470 (SPYJRS4_1146) | - | 1109630..1110142 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| SPYJRS4_RS05475 (SPYJRS4_1147) | - | 1110139..1110471 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| SPYJRS4_RS05480 (SPYJRS4_1148) | - | 1110482..1111828 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| SPYJRS4_RS05485 (SPYJRS4_1149) | - | 1111825..1112220 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| SPYJRS4_RS05490 (SPYJRS4_1151) | - | 1112585..1113382 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SPYJRS4_RS05495 (SPYJRS4_1152) | - | 1113375..1113575 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| SPYJRS4_RS05500 (SPYJRS4_1153) | - | 1113572..1114498 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| SPYJRS4_RS05505 (SPYJRS4_1154) | - | 1114501..1114830 (-) | 330 | WP_010922207.1 | hypothetical protein | - |
| SPYJRS4_RS05510 (SPYJRS4_1155) | - | 1114886..1115092 (-) | 207 | WP_002990074.1 | hypothetical protein | - |
| SPYJRS4_RS09430 (SPYJRS4_1156) | - | 1115101..1115241 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| SPYJRS4_RS05515 (SPYJRS4_1157) | - | 1115238..1115471 (-) | 234 | WP_002988350.1 | hypothetical protein | - |
| SPYJRS4_RS05520 (SPYJRS4_1158) | - | 1115452..1115838 (-) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| SPYJRS4_RS09615 (SPYJRS4_1159) | - | 1115979..1116248 (-) | 270 | WP_011106700.1 | replication protein | - |
| SPYJRS4_RS05530 (SPYJRS4_1160) | - | 1116342..1116527 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| SPYJRS4_RS05535 (SPYJRS4_1161) | - | 1116529..1116840 (-) | 312 | WP_010922478.1 | excisionase | - |
| SPYJRS4_RS05540 (SPYJRS4_1163) | - | 1117110..1117322 (-) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| SPYJRS4_RS05545 (SPYJRS4_1164) | - | 1117523..1118278 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| SPYJRS4_RS05550 (SPYJRS4_1165) | - | 1118290..1118808 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SPYJRS4_RS05555 (SPYJRS4_1166) | - | 1118932..1120074 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| SPYJRS4_RS05560 (SPYJRS4_1167) | - | 1120163..1120438 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SPYJRS4_RS05565 (SPYJRS4_1168) | - | 1120537..1121124 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| SPYJRS4_RS05570 (SPYJRS4_1169) | - | 1121102..1121944 (-) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=65187 SPYJRS4_RS05305 WP_011184726.1 1085636..1085818(-) (prx) [Streptococcus pyogenes JRS4]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=65187 SPYJRS4_RS05305 WP_011184726.1 1085636..1085818(-) (prx) [Streptococcus pyogenes JRS4]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |