Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYOHK_RS06430 | Genome accession | NZ_AFRY01000001 |
| Coordinates | 530744..530923 (+) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes HKU QMH11M0907901 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 489337..538806 | 530744..530923 | within | 0 |
Gene organization within MGE regions
Location: 489337..538806
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYOHK_RS06685 (SPYOHK_02390) | - | 489337..490416 (-) | 1080 | WP_002988667.1 | site-specific integrase | - |
| SPYOHK_RS06680 (SPYOHK_02395) | - | 490533..491084 (-) | 552 | WP_002988670.1 | hypothetical protein | - |
| SPYOHK_RS06675 (SPYOHK_02400) | - | 491095..491478 (-) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYOHK_RS06670 (SPYOHK_02405) | - | 491492..491842 (-) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| SPYOHK_RS10025 (SPYOHK_02410) | - | 492168..492323 (+) | 156 | WP_002988678.1 | hypothetical protein | - |
| SPYOHK_RS06665 (SPYOHK_02415) | - | 492304..492717 (-) | 414 | WP_002988681.1 | hypothetical protein | - |
| SPYOHK_RS06660 (SPYOHK_02420) | - | 492765..492980 (+) | 216 | WP_002988684.1 | hypothetical protein | - |
| SPYOHK_RS06655 (SPYOHK_02425) | - | 493042..493317 (+) | 276 | WP_002988687.1 | hypothetical protein | - |
| SPYOHK_RS09490 (SPYOHK_02430) | - | 493314..493484 (+) | 171 | WP_002988693.1 | hypothetical protein | - |
| SPYOHK_RS06650 (SPYOHK_02435) | - | 493477..493680 (+) | 204 | WP_002988697.1 | hypothetical protein | - |
| SPYOHK_RS06645 (SPYOHK_02440) | - | 493677..494063 (+) | 387 | WP_002988700.1 | hypothetical protein | - |
| SPYOHK_RS06635 (SPYOHK_02450) | - | 494210..494413 (+) | 204 | WP_002988705.1 | hypothetical protein | - |
| SPYOHK_RS06630 (SPYOHK_02455) | - | 494501..494800 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| SPYOHK_RS06625 (SPYOHK_02460) | - | 494800..495954 (+) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| SPYOHK_RS06620 (SPYOHK_02465) | - | 495958..496356 (+) | 399 | WP_002988715.1 | hypothetical protein | - |
| SPYOHK_RS06615 (SPYOHK_02470) | - | 496367..496924 (+) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| SPYOHK_RS06610 (SPYOHK_02475) | - | 496967..498889 (+) | 1923 | WP_002988723.1 | DNA polymerase | - |
| SPYOHK_RS06605 (SPYOHK_02480) | - | 498894..501278 (+) | 2385 | WP_002988726.1 | phage/plasmid primase, P4 family | - |
| SPYOHK_RS06600 (SPYOHK_02485) | - | 501657..502520 (+) | 864 | WP_002987985.1 | IS982-like element ISSpy2 family transposase | - |
| SPYOHK_RS06595 (SPYOHK_02490) | - | 502634..502909 (+) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| SPYOHK_RS06590 (SPYOHK_02495) | - | 502906..504228 (+) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| SPYOHK_RS10030 (SPYOHK_02500) | - | 504229..504396 (+) | 168 | WP_002988735.1 | hypothetical protein | - |
| SPYOHK_RS06585 (SPYOHK_02505) | - | 504393..504659 (+) | 267 | WP_002988738.1 | hypothetical protein | - |
| SPYOHK_RS06580 (SPYOHK_02510) | - | 504668..505519 (+) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| SPYOHK_RS06575 (SPYOHK_02515) | - | 505509..505700 (+) | 192 | WP_002988743.1 | hypothetical protein | - |
| SPYOHK_RS06570 (SPYOHK_02520) | - | 505697..506113 (+) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| SPYOHK_RS06565 (SPYOHK_02525) | - | 506203..506655 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| SPYOHK_RS06560 (SPYOHK_02530) | - | 506645..507922 (+) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| SPYOHK_RS06555 (SPYOHK_02535) | - | 507938..509470 (+) | 1533 | WP_002988758.1 | phage portal protein | - |
| SPYOHK_RS06550 (SPYOHK_02540) | - | 509430..510875 (+) | 1446 | WP_015446273.1 | minor capsid protein | - |
| SPYOHK_RS06545 (SPYOHK_02545) | - | 510906..511094 (+) | 189 | WP_002983423.1 | hypothetical protein | - |
| SPYOHK_RS06540 (SPYOHK_02550) | - | 511097..511363 (+) | 267 | WP_002988765.1 | hypothetical protein | - |
| SPYOHK_RS06535 (SPYOHK_02555) | - | 511519..512088 (+) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| SPYOHK_RS06530 (SPYOHK_02560) | - | 512101..512988 (+) | 888 | WP_002988771.1 | hypothetical protein | - |
| SPYOHK_RS06525 (SPYOHK_02565) | - | 513000..513356 (+) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| SPYOHK_RS06520 (SPYOHK_02570) | - | 513367..513645 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| SPYOHK_RS06515 (SPYOHK_02575) | - | 513642..513986 (+) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SPYOHK_RS06510 (SPYOHK_02580) | - | 513990..514349 (+) | 360 | WP_002988782.1 | hypothetical protein | - |
| SPYOHK_RS06505 (SPYOHK_02585) | - | 514361..514960 (+) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| SPYOHK_RS06500 (SPYOHK_02590) | - | 515014..515469 (+) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| SPYOHK_RS06495 (SPYOHK_02595) | - | 515544..515777 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| SPYOHK_RS06490 (SPYOHK_02600) | - | 515792..520174 (+) | 4383 | WP_002988786.1 | tape measure protein | - |
| SPYOHK_RS06485 (SPYOHK_02605) | - | 520186..521028 (+) | 843 | WP_002988788.1 | phage tail family protein | - |
| SPYOHK_RS06480 (SPYOHK_02610) | - | 521038..523020 (+) | 1983 | WP_002988790.1 | phage tail protein | - |
| SPYOHK_RS06475 (SPYOHK_02615) | - | 523017..524072 (+) | 1056 | WP_002988439.1 | hypothetical protein | - |
| SPYOHK_RS06470 (SPYOHK_02620) | - | 524072..524707 (+) | 636 | WP_002988442.1 | hypothetical protein | - |
| SPYOHK_RS06465 (SPYOHK_02625) | - | 524718..526625 (+) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| SPYOHK_RS09495 (SPYOHK_02630) | - | 526634..526795 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| SPYOHK_RS06460 (SPYOHK_02635) | - | 526798..527418 (+) | 621 | WP_002988797.1 | hypothetical protein | - |
| SPYOHK_RS06455 (SPYOHK_02640) | - | 527429..527728 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| SPYOHK_RS06450 (SPYOHK_02645) | - | 527725..527910 (+) | 186 | WP_002988802.1 | holin | - |
| SPYOHK_RS06440 (SPYOHK_02655) | - | 528021..529217 (+) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| SPYOHK_RS06435 (SPYOHK_02660) | sda1 | 529333..530505 (-) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| SPYOHK_RS06430 (SPYOHK_02665) | prx | 530744..530923 (+) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| SPYOHK_RS06425 (SPYOHK_02670) | rimP | 531168..531704 (+) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| SPYOHK_RS06420 (SPYOHK_02675) | nusA | 531879..533036 (+) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| SPYOHK_RS06415 (SPYOHK_02680) | rnpM | 533052..533348 (+) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| SPYOHK_RS06410 (SPYOHK_02685) | - | 533341..533643 (+) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| SPYOHK_RS06405 (SPYOHK_02690) | infB | 533663..536524 (+) | 2862 | WP_002983491.1 | translation initiation factor IF-2 | - |
| SPYOHK_RS06400 (SPYOHK_02695) | rbfA | 536730..537080 (+) | 351 | WP_002988820.1 | 30S ribosome-binding factor RbfA | - |
| SPYOHK_RS06395 (SPYOHK_02700) | - | 537211..538188 (-) | 978 | WP_223845213.1 | alpha/beta hydrolase fold domain-containing protein | - |
| SPYOHK_RS06390 (SPYOHK_02705) | - | 538372..538806 (+) | 435 | WP_002988824.1 | CopY/TcrY family copper transport repressor | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=64636 SPYOHK_RS06430 WP_002988813.1 530744..530923(+) (prx) [Streptococcus pyogenes HKU QMH11M0907901]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=64636 SPYOHK_RS06430 WP_002988813.1 530744..530923(+) (prx) [Streptococcus pyogenes HKU QMH11M0907901]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |