Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | YBT1518_RS28345 | Genome accession | NC_022873 |
| Coordinates | 5600956..5601537 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049162.1 | Uniprot ID | A0A9W5QPC2 |
| Organism | Bacillus thuringiensis YBT-1518 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5566279..5601537 | 5600956..5601537 | within | 0 |
Gene organization within MGE regions
Location: 5566279..5601537
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| YBT1518_RS28130 (YBT1518_28605) | - | 5566279..5566524 (-) | 246 | WP_000869730.1 | glutaredoxin family protein | - |
| YBT1518_RS28135 (YBT1518_28610) | rpoN | 5566534..5567841 (-) | 1308 | WP_000647953.1 | RNA polymerase factor sigma-54 | - |
| YBT1518_RS28140 (YBT1518_28615) | - | 5568143..5568340 (-) | 198 | WP_000505575.1 | hypothetical protein | - |
| YBT1518_RS28145 (YBT1518_28620) | - | 5568360..5569388 (-) | 1029 | WP_023523426.1 | ABC transporter permease | - |
| YBT1518_RS28150 (YBT1518_28625) | - | 5569585..5570469 (-) | 885 | WP_023523427.1 | ABC transporter ATP-binding protein | - |
| YBT1518_RS28155 (YBT1518_28630) | - | 5570786..5573104 (+) | 2319 | WP_023523428.1 | sensor histidine kinase | - |
| YBT1518_RS28160 (YBT1518_28635) | - | 5573108..5573749 (+) | 642 | WP_023523429.1 | response regulator transcription factor | - |
| YBT1518_RS28165 (YBT1518_28640) | - | 5574148..5574972 (+) | 825 | WP_023523430.1 | helix-turn-helix domain-containing protein | - |
| YBT1518_RS28170 (YBT1518_28645) | - | 5574989..5575282 (-) | 294 | WP_023523431.1 | YolD-like family protein | - |
| YBT1518_RS38830 (YBT1518_28650) | - | 5575649..5577034 (-) | 1386 | WP_023523432.1 | beta-propeller fold lactonase family protein | - |
| YBT1518_RS37210 | - | 5577282..5577452 (+) | 171 | WP_157762869.1 | hypothetical protein | - |
| YBT1518_RS39005 | - | 5577482..5577712 (+) | 231 | WP_370451655.1 | hypothetical protein | - |
| YBT1518_RS28185 (YBT1518_28655) | - | 5579399..5580460 (-) | 1062 | WP_023523433.1 | N-acetylmuramoyl-L-alanine amidase | - |
| YBT1518_RS28190 (YBT1518_28660) | - | 5580457..5580696 (-) | 240 | WP_023523434.1 | hypothetical protein | - |
| YBT1518_RS28195 (YBT1518_28665) | - | 5580696..5580932 (-) | 237 | WP_000398737.1 | hemolysin XhlA family protein | - |
| YBT1518_RS28200 (YBT1518_28670) | ltrA | 5581034..5582308 (-) | 1275 | WP_023520826.1 | group II intron reverse transcriptase/maturase | - |
| YBT1518_RS28205 | - | 5582898..5583301 (-) | 404 | Protein_5643 | CHRD domain-containing protein | - |
| YBT1518_RS28215 (YBT1518_28685) | - | 5584618..5585007 (-) | 390 | WP_023523437.1 | hypothetical protein | - |
| YBT1518_RS35915 (YBT1518_28690) | - | 5585025..5585147 (-) | 123 | WP_006921851.1 | DUF3983 domain-containing protein | - |
| YBT1518_RS28220 (YBT1518_28695) | - | 5585316..5585510 (-) | 195 | WP_023523438.1 | hypothetical protein | - |
| YBT1518_RS28225 (YBT1518_28700) | - | 5585965..5586510 (-) | 546 | WP_023523439.1 | ERCC4 domain-containing protein | - |
| YBT1518_RS28230 (YBT1518_28705) | - | 5586501..5586935 (-) | 435 | WP_023523440.1 | hypothetical protein | - |
| YBT1518_RS28235 (YBT1518_28710) | - | 5586923..5587147 (-) | 225 | WP_023523441.1 | primase-like DNA-binding domain-containing protein | - |
| YBT1518_RS28240 (YBT1518_28715) | - | 5587418..5589772 (-) | 2355 | WP_023523442.1 | phage/plasmid primase, P4 family | - |
| YBT1518_RS28245 (YBT1518_28720) | - | 5589845..5590321 (-) | 477 | WP_023523443.1 | DUF669 domain-containing protein | - |
| YBT1518_RS28250 (YBT1518_28725) | - | 5590342..5591013 (-) | 672 | WP_043924723.1 | AAA family ATPase | - |
| YBT1518_RS28255 (YBT1518_28730) | - | 5591019..5591210 (-) | 192 | WP_023521063.1 | hypothetical protein | - |
| YBT1518_RS37215 | - | 5591207..5591392 (-) | 186 | WP_157447755.1 | hypothetical protein | - |
| YBT1518_RS28265 (YBT1518_28735) | - | 5591681..5592028 (-) | 348 | WP_023523445.1 | hypothetical protein | - |
| YBT1518_RS28270 (YBT1518_28740) | - | 5592327..5593520 (+) | 1194 | WP_023521170.1 | IS110 family transposase | - |
| YBT1518_RS28275 | - | 5593600..5593779 (-) | 180 | WP_043924724.1 | hypothetical protein | - |
| YBT1518_RS28280 (YBT1518_28745) | - | 5593838..5594071 (-) | 234 | WP_023523446.1 | DUF771 domain-containing protein | - |
| YBT1518_RS28285 (YBT1518_28750) | - | 5594106..5594336 (-) | 231 | WP_023523447.1 | helix-turn-helix transcriptional regulator | - |
| YBT1518_RS28290 (YBT1518_28755) | - | 5594501..5594893 (+) | 393 | WP_023523448.1 | helix-turn-helix transcriptional regulator | - |
| YBT1518_RS28295 (YBT1518_28760) | - | 5594904..5595371 (+) | 468 | WP_043924725.1 | hypothetical protein | - |
| YBT1518_RS28300 | - | 5595402..5596537 (+) | 1136 | Protein_5662 | tyrosine-type recombinase/integrase | - |
| YBT1518_RS28310 (YBT1518_28775) | - | 5596952..5597158 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| YBT1518_RS28315 (YBT1518_28780) | - | 5597252..5597737 (+) | 486 | WP_001228545.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| YBT1518_RS28320 (YBT1518_28785) | spoVAC | 5597767..5598243 (+) | 477 | WP_000095399.1 | stage V sporulation protein AC | - |
| YBT1518_RS28325 (YBT1518_28790) | spoVAD | 5598244..5599260 (+) | 1017 | WP_000938970.1 | stage V sporulation protein AD | - |
| YBT1518_RS28330 (YBT1518_28795) | spoVAE | 5599257..5599607 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| YBT1518_RS28335 (YBT1518_28800) | - | 5599619..5599825 (+) | 207 | WP_000215897.1 | DUF1657 domain-containing protein | - |
| YBT1518_RS28340 (YBT1518_28805) | - | 5599846..5600715 (+) | 870 | WP_000018924.1 | DUF421 domain-containing protein | - |
| YBT1518_RS28345 (YBT1518_28810) | clpP | 5600956..5601537 (+) | 582 | WP_001049162.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21419.67 Da Isoelectric Point: 5.0423
>NTDB_id=63643 YBT1518_RS28345 WP_001049162.1 5600956..5601537(+) (clpP) [Bacillus thuringiensis YBT-1518]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=63643 YBT1518_RS28345 WP_001049162.1 5600956..5601537(+) (clpP) [Bacillus thuringiensis YBT-1518]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCGGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTACGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGTGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCGGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCGGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTACGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGTGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCGGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
90.104 |
99.482 |
0.896 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |