Detailed information
Bioinformatically predicted
Overview
| Name | pilA2 | Type | Machinery gene |
| Locus tag | LOY63_RS04370 | Genome accession | NZ_CP087202 |
| Coordinates | 971274..971672 (+) | Length | 132 a.a. |
| NCBI ID | WP_265085290.1 | Uniprot ID | - |
| Organism | Pseudomonas asplenii strain B21-058 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 950539..985783 | 971274..971672 | within | 0 |
Gene organization within MGE regions
Location: 950539..985783
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOY63_RS04260 (LOY63_04260) | - | 950539..951633 (+) | 1095 | WP_010451855.1 | glycosyltransferase family 1 protein | - |
| LOY63_RS04265 (LOY63_04265) | - | 951638..952597 (+) | 960 | WP_265085276.1 | GDP-mannose 4,6-dehydratase | - |
| LOY63_RS04270 (LOY63_04270) | gmd | 952629..953753 (+) | 1125 | WP_265085277.1 | GDP-mannose 4,6-dehydratase | - |
| LOY63_RS04275 (LOY63_04275) | - | 953755..954732 (+) | 978 | WP_265085278.1 | GDP-L-fucose synthase | - |
| LOY63_RS04280 | - | 954875..955366 (+) | 492 | WP_010451863.1 | DapH/DapD/GlmU-related protein | - |
| LOY63_RS04285 (LOY63_04285) | - | 955363..956547 (+) | 1185 | WP_010451865.1 | glycosyltransferase | - |
| LOY63_RS04290 (LOY63_04290) | - | 956544..957710 (+) | 1167 | WP_265085279.1 | glycosyltransferase family 4 protein | - |
| LOY63_RS04295 (LOY63_04295) | - | 957707..958831 (+) | 1125 | WP_265085280.1 | glycosyltransferase | - |
| LOY63_RS04300 (LOY63_04300) | - | 958832..960241 (+) | 1410 | WP_265085281.1 | mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | - |
| LOY63_RS04305 (LOY63_04305) | - | 960251..961018 (+) | 768 | WP_265085282.1 | glycosyltransferase family 2 protein | - |
| LOY63_RS04310 (LOY63_04310) | - | 961018..961977 (+) | 960 | WP_265085283.1 | SDR family oxidoreductase | - |
| LOY63_RS04315 (LOY63_04315) | - | 962073..962894 (+) | 822 | WP_080579433.1 | class I SAM-dependent methyltransferase | - |
| LOY63_RS04320 (LOY63_04320) | - | 962972..964279 (-) | 1308 | WP_090202196.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| LOY63_RS04325 (LOY63_04325) | - | 964343..964516 (-) | 174 | WP_265085284.1 | DUF3094 domain-containing protein | - |
| LOY63_RS04330 (LOY63_04330) | - | 964690..965319 (-) | 630 | WP_010451875.1 | DUF1780 domain-containing protein | - |
| LOY63_RS04335 (LOY63_04335) | - | 965439..966137 (+) | 699 | WP_265085285.1 | energy-coupling factor ABC transporter permease | - |
| LOY63_RS04340 (LOY63_04340) | - | 966205..966420 (+) | 216 | WP_010451878.1 | hypothetical protein | - |
| LOY63_RS04345 (LOY63_04345) | yacG | 966432..966635 (-) | 204 | WP_010451880.1 | DNA gyrase inhibitor YacG | - |
| LOY63_RS04350 (LOY63_04350) | coaE | 966632..967255 (-) | 624 | WP_265085286.1 | dephospho-CoA kinase | - |
| LOY63_RS04355 (LOY63_04355) | pilD | 967255..968124 (-) | 870 | WP_265085287.1 | A24 family peptidase | Machinery gene |
| LOY63_RS04360 (LOY63_04360) | pilC | 968128..969345 (-) | 1218 | WP_265085288.1 | type II secretion system F family protein | Machinery gene |
| LOY63_RS04365 (LOY63_04365) | pilB | 969349..971049 (-) | 1701 | WP_265085289.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| LOY63_RS04370 (LOY63_04370) | pilA2 | 971274..971672 (+) | 399 | WP_265085290.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| LOY63_RS04375 (LOY63_04375) | - | 971793..973439 (+) | 1647 | WP_265085291.1 | tetratricopeptide repeat protein | - |
| LOY63_RS04380 (LOY63_04380) | - | 973848..974897 (+) | 1050 | WP_265085292.1 | O-antigen ligase | - |
| LOY63_RS04390 (LOY63_04390) | - | 975423..976379 (-) | 957 | WP_265085293.1 | hypothetical protein | - |
| LOY63_RS04395 (LOY63_04395) | - | 976421..977605 (-) | 1185 | WP_265085294.1 | amidohydrolase family protein | - |
| LOY63_RS04400 (LOY63_04400) | - | 977624..978643 (-) | 1020 | WP_265085295.1 | TauD/TfdA family dioxygenase | - |
| LOY63_RS04405 (LOY63_04405) | - | 978796..979998 (-) | 1203 | WP_265085296.1 | MFS transporter | - |
| LOY63_RS04410 (LOY63_04410) | asnB | 980059..981909 (-) | 1851 | WP_265085297.1 | asparagine synthase (glutamine-hydrolyzing) | - |
| LOY63_RS04415 (LOY63_04415) | - | 981932..982999 (-) | 1068 | WP_265085298.1 | Gfo/Idh/MocA family oxidoreductase | - |
| LOY63_RS04420 (LOY63_04420) | - | 982996..983502 (-) | 507 | WP_265085299.1 | GNAT family N-acetyltransferase | - |
| LOY63_RS04425 (LOY63_04425) | hemA | 983499..984731 (-) | 1233 | WP_265085300.1 | 5-aminolevulinate synthase | - |
| LOY63_RS04430 (LOY63_04430) | - | 984878..985783 (+) | 906 | WP_265085301.1 | helix-turn-helix transcriptional regulator | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 13416.35 Da Isoelectric Point: 7.5895
>NTDB_id=628031 LOY63_RS04370 WP_265085290.1 971274..971672(+) (pilA2) [Pseudomonas asplenii strain B21-058]
MNAQKGFTLIELMIVVAIIGILAAIALPAYNSYTQKARFAEVNTMADAYKTAVAVCINDLGTKTNCTAGSNGIPAIPAAT
PNFASGSVTDGTISLTGTNAAGNWTTILTPTLNAGNITWAQTGTCAAANTCK
MNAQKGFTLIELMIVVAIIGILAAIALPAYNSYTQKARFAEVNTMADAYKTAVAVCINDLGTKTNCTAGSNGIPAIPAAT
PNFASGSVTDGTISLTGTNAAGNWTTILTPTLNAGNITWAQTGTCAAANTCK
Nucleotide
Download Length: 399 bp
>NTDB_id=628031 LOY63_RS04370 WP_265085290.1 971274..971672(+) (pilA2) [Pseudomonas asplenii strain B21-058]
ATGAATGCTCAAAAGGGTTTCACCTTGATCGAACTGATGATCGTTGTGGCGATCATCGGTATTTTGGCGGCGATTGCGTT
GCCAGCGTATAACAGCTACACGCAGAAGGCCCGCTTTGCCGAAGTGAATACTATGGCTGACGCCTATAAGACGGCCGTGG
CGGTCTGCATTAATGATCTAGGTACTAAAACCAACTGTACGGCAGGTTCCAATGGTATCCCTGCCATCCCTGCTGCCACT
CCTAACTTCGCGTCTGGTTCTGTAACTGACGGTACAATCAGTTTGACGGGGACTAATGCTGCGGGTAACTGGACAACTAT
CCTCACACCTACTCTCAATGCTGGTAATATCACTTGGGCTCAGACTGGCACCTGTGCAGCGGCTAACACTTGTAAATGA
ATGAATGCTCAAAAGGGTTTCACCTTGATCGAACTGATGATCGTTGTGGCGATCATCGGTATTTTGGCGGCGATTGCGTT
GCCAGCGTATAACAGCTACACGCAGAAGGCCCGCTTTGCCGAAGTGAATACTATGGCTGACGCCTATAAGACGGCCGTGG
CGGTCTGCATTAATGATCTAGGTACTAAAACCAACTGTACGGCAGGTTCCAATGGTATCCCTGCCATCCCTGCTGCCACT
CCTAACTTCGCGTCTGGTTCTGTAACTGACGGTACAATCAGTTTGACGGGGACTAATGCTGCGGGTAACTGGACAACTAT
CCTCACACCTACTCTCAATGCTGGTAATATCACTTGGGCTCAGACTGGCACCTGTGCAGCGGCTAACACTTGTAAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA2 | Legionella pneumophila str. Paris |
52.308 |
98.485 |
0.515 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
52.308 |
98.485 |
0.515 |
| comP | Acinetobacter baylyi ADP1 |
50 |
98.485 |
0.492 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
40.714 |
100 |
0.432 |
| pilA | Haemophilus influenzae 86-028NP |
44.628 |
91.667 |
0.409 |
| pilA | Haemophilus influenzae Rd KW20 |
43.802 |
91.667 |
0.402 |
| pilA | Glaesserella parasuis strain SC1401 |
43.802 |
91.667 |
0.402 |