Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | LLZ90_RS03305 | Genome accession | NZ_CP086129 |
| Coordinates | 603690..603878 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain MIN-181 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 594904..603648 | 603690..603878 | flank | 42 |
| IS/Tn | 602623..603234 | 603690..603878 | flank | 456 |
Gene organization within MGE regions
Location: 594904..603878
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLZ90_RS03265 (LLZ90_03260) | - | 596283..596444 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| LLZ90_RS03270 (LLZ90_03265) | - | 597186..598463 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| LLZ90_RS03275 (LLZ90_03270) | - | 598473..599129 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| LLZ90_RS03280 (LLZ90_03275) | - | 599129..600505 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| LLZ90_RS03285 (LLZ90_03280) | - | 600602..601255 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| LLZ90_RS03290 (LLZ90_03285) | - | 601252..602571 (+) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| LLZ90_RS03295 (LLZ90_03290) | - | 602623..603270 (-) | 648 | Protein_566 | IS3 family transposase | - |
| LLZ90_RS03300 (LLZ90_03295) | - | 603448..603648 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| LLZ90_RS03305 (LLZ90_03300) | prx | 603690..603878 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=622757 LLZ90_RS03305 WP_000027835.1 603690..603878(+) (prx) [Streptococcus agalactiae strain MIN-181]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=622757 LLZ90_RS03305 WP_000027835.1 603690..603878(+) (prx) [Streptococcus agalactiae strain MIN-181]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |