Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | LIO32_RS07860 | Genome accession | NZ_CP085087 |
| Coordinates | 1575693..1575911 (-) | Length | 72 a.a. |
| NCBI ID | WP_074389676.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain Ssuis_MA2 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1575693..1598351 | 1575693..1575911 | within | 0 |
Gene organization within MGE regions
Location: 1575693..1598351
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIO32_RS07860 | prx | 1575693..1575911 (-) | 219 | WP_074389676.1 | Paratox | Regulator |
| LIO32_RS07865 | - | 1576119..1576856 (-) | 738 | WP_074389675.1 | PlySs2 family phage lysin | - |
| LIO32_RS07870 | - | 1576840..1577190 (-) | 351 | WP_074389674.1 | phage holin | - |
| LIO32_RS07875 | - | 1577201..1577536 (-) | 336 | WP_023371100.1 | hypothetical protein | - |
| LIO32_RS07880 | - | 1577540..1577878 (-) | 339 | WP_023371101.1 | hypothetical protein | - |
| LIO32_RS07885 | - | 1577987..1578259 (-) | 273 | WP_226960409.1 | hypothetical protein | - |
| LIO32_RS07890 | - | 1578284..1578643 (-) | 360 | WP_074389673.1 | hypothetical protein | - |
| LIO32_RS07895 | - | 1578670..1579044 (-) | 375 | WP_074389672.1 | DUF6096 family protein | - |
| LIO32_RS07900 | - | 1579055..1579477 (-) | 423 | WP_074389671.1 | phage tail tube protein | - |
| LIO32_RS07905 | - | 1579481..1579849 (-) | 369 | WP_002936856.1 | hypothetical protein | - |
| LIO32_RS07910 | - | 1579846..1580358 (-) | 513 | WP_074389670.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LIO32_RS07915 | - | 1580626..1580955 (-) | 330 | WP_074389668.1 | phage head-tail connector protein | - |
| LIO32_RS07920 | - | 1580965..1581153 (-) | 189 | WP_044693053.1 | hypothetical protein | - |
| LIO32_RS07925 | - | 1581164..1582180 (-) | 1017 | WP_074389667.1 | sugar-binding protein | - |
| LIO32_RS07930 | - | 1582199..1582744 (-) | 546 | WP_074389666.1 | DUF4355 domain-containing protein | - |
| LIO32_RS07935 | - | 1582857..1582997 (-) | 141 | WP_226960410.1 | crAss001_48 related protein | - |
| LIO32_RS07940 | terL | 1583023..1584444 (-) | 1422 | WP_074389664.1 | phage terminase large subunit | - |
| LIO32_RS07950 | - | 1584489..1584812 (-) | 324 | Protein_1523 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LIO32_RS07955 | - | 1584884..1585360 (-) | 477 | WP_074389663.1 | helix-turn-helix transcriptional regulator | - |
| LIO32_RS07960 | - | 1585563..1585769 (-) | 207 | WP_074389661.1 | hypothetical protein | - |
| LIO32_RS07965 | - | 1585766..1585909 (-) | 144 | WP_171840747.1 | hypothetical protein | - |
| LIO32_RS07970 | - | 1585909..1586139 (-) | 231 | WP_074389660.1 | hypothetical protein | - |
| LIO32_RS07975 | - | 1586521..1586736 (-) | 216 | WP_074389658.1 | hypothetical protein | - |
| LIO32_RS07980 | - | 1586733..1587023 (-) | 291 | WP_074389657.1 | hypothetical protein | - |
| LIO32_RS07985 | - | 1587023..1587265 (-) | 243 | WP_074389656.1 | hypothetical protein | - |
| LIO32_RS07990 | - | 1587265..1587783 (-) | 519 | WP_079845830.1 | DUF1642 domain-containing protein | - |
| LIO32_RS07995 | - | 1587780..1588088 (-) | 309 | WP_074389655.1 | DUF1372 family protein | - |
| LIO32_RS08000 | - | 1588075..1588293 (-) | 219 | WP_024393800.1 | hypothetical protein | - |
| LIO32_RS08005 | - | 1588280..1588687 (-) | 408 | WP_074389654.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LIO32_RS08010 | - | 1588684..1588893 (-) | 210 | WP_074389653.1 | hypothetical protein | - |
| LIO32_RS08015 | - | 1589228..1591501 (-) | 2274 | WP_074389652.1 | AAA family ATPase | - |
| LIO32_RS08020 | - | 1591510..1593093 (-) | 1584 | WP_074389651.1 | DEAD/DEAH box helicase | - |
| LIO32_RS08025 | - | 1593103..1593675 (-) | 573 | WP_074389650.1 | hypothetical protein | - |
| LIO32_RS08030 | - | 1593694..1594428 (-) | 735 | WP_074389649.1 | hypothetical protein | - |
| LIO32_RS08035 | - | 1594430..1594849 (-) | 420 | WP_024393806.1 | hypothetical protein | - |
| LIO32_RS08040 | - | 1594897..1595997 (-) | 1101 | WP_074389648.1 | ATP-binding protein | - |
| LIO32_RS08045 | - | 1595997..1597289 (-) | 1293 | WP_074389647.1 | AAA family ATPase | - |
| LIO32_RS08050 | - | 1597270..1597470 (-) | 201 | WP_074389646.1 | hypothetical protein | - |
| LIO32_RS08055 | - | 1597503..1598351 (+) | 849 | WP_074389645.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 72 a.a. Molecular weight: 8186.24 Da Isoelectric Point: 4.3895
>NTDB_id=615285 LIO32_RS07860 WP_074389676.1 1575693..1575911(-) (prx) [Streptococcus suis strain Ssuis_MA2]
MLEYEELKQAVDDGYVTGDTVNIVRRDGKVFDYVLPGEQVRSWEAVSEEKVEDVLKELKKTLSRGRGIVGEL
MLEYEELKQAVDDGYVTGDTVNIVRRDGKVFDYVLPGEQVRSWEAVSEEKVEDVLKELKKTLSRGRGIVGEL
Nucleotide
Download Length: 219 bp
>NTDB_id=615285 LIO32_RS07860 WP_074389676.1 1575693..1575911(-) (prx) [Streptococcus suis strain Ssuis_MA2]
ATGTTAGAATACGAAGAATTAAAGCAAGCAGTAGATGATGGATATGTCACAGGCGATACGGTAAATATCGTACGTCGTGA
CGGTAAGGTATTTGACTATGTTTTACCAGGCGAGCAAGTCAGGTCGTGGGAAGCGGTGAGCGAGGAGAAGGTGGAAGATG
TGTTGAAGGAATTAAAAAAGACCTTGTCCAGAGGTCGGGGAATAGTCGGGGAGTTGTAA
ATGTTAGAATACGAAGAATTAAAGCAAGCAGTAGATGATGGATATGTCACAGGCGATACGGTAAATATCGTACGTCGTGA
CGGTAAGGTATTTGACTATGTTTTACCAGGCGAGCAAGTCAGGTCGTGGGAAGCGGTGAGCGAGGAGAAGGTGGAAGATG
TGTTGAAGGAATTAAAAAAGACCTTGTCCAGAGGTCGGGGAATAGTCGGGGAGTTGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
63.333 |
83.333 |
0.528 |
| prx | Streptococcus pyogenes MGAS8232 |
61.667 |
83.333 |
0.514 |
| prx | Streptococcus pyogenes MGAS315 |
61.667 |
83.333 |
0.514 |
| prx | Streptococcus pyogenes MGAS315 |
58.333 |
83.333 |
0.486 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
58.333 |
0.389 |
| prx | Streptococcus pyogenes MGAS315 |
64.286 |
58.333 |
0.375 |
| prx | Streptococcus pyogenes MGAS315 |
61.905 |
58.333 |
0.361 |