Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | LIO31_RS07715 | Genome accession | NZ_CP085086 |
| Coordinates | 1536902..1537120 (-) | Length | 72 a.a. |
| NCBI ID | WP_074389676.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain Ssuis_MA6 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1536902..1559560 | 1536902..1537120 | within | 0 |
Gene organization within MGE regions
Location: 1536902..1559560
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIO31_RS07715 | prx | 1536902..1537120 (-) | 219 | WP_074389676.1 | Paratox | Regulator |
| LIO31_RS07720 | - | 1537328..1538065 (-) | 738 | WP_074389675.1 | PlySs2 family phage lysin | - |
| LIO31_RS07725 | - | 1538049..1538399 (-) | 351 | WP_074389674.1 | phage holin | - |
| LIO31_RS07730 | - | 1538410..1538745 (-) | 336 | WP_023371100.1 | hypothetical protein | - |
| LIO31_RS07735 | - | 1538749..1539087 (-) | 339 | WP_023371101.1 | hypothetical protein | - |
| LIO31_RS07740 | - | 1539196..1539468 (-) | 273 | WP_226960409.1 | hypothetical protein | - |
| LIO31_RS07745 | - | 1539493..1539852 (-) | 360 | WP_074389673.1 | hypothetical protein | - |
| LIO31_RS07750 | - | 1539879..1540253 (-) | 375 | WP_074389672.1 | DUF6096 family protein | - |
| LIO31_RS07755 | - | 1540264..1540686 (-) | 423 | WP_074389671.1 | phage tail tube protein | - |
| LIO31_RS07760 | - | 1540690..1541058 (-) | 369 | WP_002936856.1 | hypothetical protein | - |
| LIO31_RS07765 | - | 1541055..1541567 (-) | 513 | WP_074389670.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LIO31_RS07770 | - | 1541835..1542164 (-) | 330 | WP_074389668.1 | phage head-tail connector protein | - |
| LIO31_RS07775 | - | 1542174..1542362 (-) | 189 | WP_044693053.1 | hypothetical protein | - |
| LIO31_RS07780 | - | 1542373..1543389 (-) | 1017 | WP_074389667.1 | sugar-binding protein | - |
| LIO31_RS07785 | - | 1543408..1543953 (-) | 546 | WP_074389666.1 | DUF4355 domain-containing protein | - |
| LIO31_RS07790 | - | 1544066..1544287 (-) | 222 | WP_074389665.1 | crAss001_48 related protein | - |
| LIO31_RS07795 | terL | 1544232..1545653 (-) | 1422 | WP_074389664.1 | phage terminase large subunit | - |
| LIO31_RS07805 | - | 1545698..1546021 (-) | 324 | Protein_1495 | ArpU family phage packaging/lysis transcriptional regulator | - |
| LIO31_RS07810 | - | 1546093..1546569 (-) | 477 | WP_074389663.1 | helix-turn-helix transcriptional regulator | - |
| LIO31_RS07815 | - | 1546772..1546978 (-) | 207 | WP_074389661.1 | hypothetical protein | - |
| LIO31_RS07820 | - | 1546975..1547118 (-) | 144 | WP_171840747.1 | hypothetical protein | - |
| LIO31_RS07825 | - | 1547118..1547348 (-) | 231 | WP_074389660.1 | hypothetical protein | - |
| LIO31_RS07830 | - | 1547730..1547945 (-) | 216 | WP_074389658.1 | hypothetical protein | - |
| LIO31_RS07835 | - | 1547942..1548232 (-) | 291 | WP_074389657.1 | hypothetical protein | - |
| LIO31_RS07840 | - | 1548232..1548474 (-) | 243 | WP_074389656.1 | hypothetical protein | - |
| LIO31_RS07845 | - | 1548474..1548992 (-) | 519 | WP_079845830.1 | DUF1642 domain-containing protein | - |
| LIO31_RS07850 | - | 1548989..1549297 (-) | 309 | WP_074389655.1 | DUF1372 family protein | - |
| LIO31_RS07855 | - | 1549284..1549502 (-) | 219 | WP_024393800.1 | hypothetical protein | - |
| LIO31_RS07860 | - | 1549489..1549896 (-) | 408 | WP_074389654.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LIO31_RS07865 | - | 1549893..1550102 (-) | 210 | WP_074389653.1 | hypothetical protein | - |
| LIO31_RS07870 | - | 1550437..1552710 (-) | 2274 | WP_074389652.1 | AAA family ATPase | - |
| LIO31_RS07875 | - | 1552719..1554302 (-) | 1584 | WP_074389651.1 | DEAD/DEAH box helicase | - |
| LIO31_RS07880 | - | 1554312..1554884 (-) | 573 | WP_074389650.1 | hypothetical protein | - |
| LIO31_RS07885 | - | 1554903..1555637 (-) | 735 | WP_074389649.1 | hypothetical protein | - |
| LIO31_RS07890 | - | 1555639..1556058 (-) | 420 | WP_024393806.1 | hypothetical protein | - |
| LIO31_RS07895 | - | 1556106..1557206 (-) | 1101 | WP_074389648.1 | ATP-binding protein | - |
| LIO31_RS07900 | - | 1557206..1558498 (-) | 1293 | WP_226960900.1 | AAA family ATPase | - |
| LIO31_RS07905 | - | 1558479..1558679 (-) | 201 | WP_074389646.1 | hypothetical protein | - |
| LIO31_RS07910 | - | 1558712..1559560 (+) | 849 | WP_074389645.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 72 a.a. Molecular weight: 8186.24 Da Isoelectric Point: 4.3895
>NTDB_id=615234 LIO31_RS07715 WP_074389676.1 1536902..1537120(-) (prx) [Streptococcus suis strain Ssuis_MA6]
MLEYEELKQAVDDGYVTGDTVNIVRRDGKVFDYVLPGEQVRSWEAVSEEKVEDVLKELKKTLSRGRGIVGEL
MLEYEELKQAVDDGYVTGDTVNIVRRDGKVFDYVLPGEQVRSWEAVSEEKVEDVLKELKKTLSRGRGIVGEL
Nucleotide
Download Length: 219 bp
>NTDB_id=615234 LIO31_RS07715 WP_074389676.1 1536902..1537120(-) (prx) [Streptococcus suis strain Ssuis_MA6]
ATGTTAGAATACGAAGAATTAAAGCAAGCAGTAGATGATGGATATGTCACAGGCGATACGGTAAATATCGTACGTCGTGA
CGGTAAGGTATTTGACTATGTTTTACCAGGCGAGCAAGTCAGGTCGTGGGAAGCGGTGAGCGAGGAGAAGGTGGAAGATG
TGTTGAAGGAATTAAAAAAGACCTTGTCCAGAGGTCGGGGAATAGTCGGGGAGTTGTAA
ATGTTAGAATACGAAGAATTAAAGCAAGCAGTAGATGATGGATATGTCACAGGCGATACGGTAAATATCGTACGTCGTGA
CGGTAAGGTATTTGACTATGTTTTACCAGGCGAGCAAGTCAGGTCGTGGGAAGCGGTGAGCGAGGAGAAGGTGGAAGATG
TGTTGAAGGAATTAAAAAAGACCTTGTCCAGAGGTCGGGGAATAGTCGGGGAGTTGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
63.333 |
83.333 |
0.528 |
| prx | Streptococcus pyogenes MGAS8232 |
61.667 |
83.333 |
0.514 |
| prx | Streptococcus pyogenes MGAS315 |
61.667 |
83.333 |
0.514 |
| prx | Streptococcus pyogenes MGAS315 |
58.333 |
83.333 |
0.486 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
58.333 |
0.389 |
| prx | Streptococcus pyogenes MGAS315 |
64.286 |
58.333 |
0.375 |
| prx | Streptococcus pyogenes MGAS315 |
61.905 |
58.333 |
0.361 |