Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | LA346_RS04830 | Genome accession | NZ_CP083627 |
| Coordinates | 906124..906249 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain FDAARGOS_1508 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 901124..911249
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LA346_RS10990 | - | 901462..903065 (-) | 1604 | Protein_914 | YhgE/Pip family protein | - |
| LA346_RS04805 (LA346_04805) | - | 903244..903786 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| LA346_RS04820 (LA346_04820) | comE | 904029..904781 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| LA346_RS04825 (LA346_04825) | comD/comD1 | 904778..906103 (-) | 1326 | WP_000362880.1 | competence system sensor histidine kinase ComD | Regulator |
| LA346_RS04830 (LA346_04830) | comC/comC1 | 906124..906249 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| LA346_RS04840 (LA346_04840) | rlmH | 906531..907010 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| LA346_RS04845 (LA346_04845) | htrA | 907193..908374 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| LA346_RS04850 (LA346_04850) | spo0J | 908432..909190 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| LA346_RS04855 (LA346_04855) | dnaA | 909403..910764 (+) | 1362 | WP_000660618.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=606835 LA346_RS04830 WP_000799689.1 906124..906249(-) (comC/comC1) [Streptococcus pneumoniae strain FDAARGOS_1508]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=606835 LA346_RS04830 WP_000799689.1 906124..906249(-) (comC/comC1) [Streptococcus pneumoniae strain FDAARGOS_1508]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |