Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | K8Z23_RS27680 | Genome accession | NZ_CP083129 |
| Coordinates | 5382906..5383487 (-) | Length | 193 a.a. |
| NCBI ID | WP_001049162.1 | Uniprot ID | A0A9W5QPC2 |
| Organism | Bacillus thuringiensis strain NB-176 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5382906..5427104 | 5382906..5383487 | within | 0 |
Gene organization within MGE regions
Location: 5382906..5427104
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K8Z23_RS27680 (K8Z23_27630) | clpP | 5382906..5383487 (-) | 582 | WP_001049162.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
| K8Z23_RS27685 (K8Z23_27635) | - | 5383728..5384597 (-) | 870 | WP_000018929.1 | DUF421 domain-containing protein | - |
| K8Z23_RS27690 (K8Z23_27640) | - | 5384618..5384824 (-) | 207 | WP_000215916.1 | DUF1657 domain-containing protein | - |
| K8Z23_RS27695 (K8Z23_27645) | spoVAE | 5384836..5385186 (-) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| K8Z23_RS27700 (K8Z23_27650) | spoVAD | 5385183..5386199 (-) | 1017 | WP_000938972.1 | stage V sporulation protein AD | - |
| K8Z23_RS27705 (K8Z23_27655) | spoVAC | 5386200..5386676 (-) | 477 | WP_000095399.1 | stage V sporulation protein AC | - |
| K8Z23_RS27710 (K8Z23_27660) | - | 5386706..5387191 (-) | 486 | WP_001228545.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| K8Z23_RS27715 (K8Z23_27665) | - | 5387285..5387491 (-) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| K8Z23_RS27725 (K8Z23_27675) | - | 5388001..5388981 (+) | 981 | WP_044798191.1 | tyrosine-type recombinase/integrase | - |
| K8Z23_RS27730 (K8Z23_27680) | - | 5389764..5390036 (+) | 273 | WP_044798188.1 | hypothetical protein | - |
| K8Z23_RS27735 (K8Z23_27685) | - | 5390148..5390351 (+) | 204 | WP_044798186.1 | hypothetical protein | - |
| K8Z23_RS27740 (K8Z23_27690) | - | 5392464..5392730 (+) | 267 | WP_044798185.1 | helix-turn-helix domain-containing protein | - |
| K8Z23_RS27745 (K8Z23_27695) | - | 5392730..5393125 (+) | 396 | WP_044798184.1 | phBC6A51 family helix-turn-helix protein | - |
| K8Z23_RS27750 (K8Z23_27700) | - | 5393147..5393752 (+) | 606 | WP_044798182.1 | hypothetical protein | - |
| K8Z23_RS27755 (K8Z23_27705) | - | 5393771..5394130 (+) | 360 | WP_044798181.1 | hypothetical protein | - |
| K8Z23_RS27760 (K8Z23_27710) | - | 5395557..5396039 (+) | 483 | WP_044798180.1 | hypothetical protein | - |
| K8Z23_RS27765 (K8Z23_27715) | rpoN | 5396689..5397996 (+) | 1308 | WP_000647951.1 | RNA polymerase factor sigma-54 | - |
| K8Z23_RS27770 (K8Z23_27720) | - | 5398006..5398251 (+) | 246 | WP_000869737.1 | glutaredoxin family protein | - |
| K8Z23_RS27775 (K8Z23_27725) | cggR | 5398388..5399416 (+) | 1029 | WP_001258185.1 | gapA transcriptional regulator CggR | - |
| K8Z23_RS27780 (K8Z23_27730) | gap | 5399443..5400447 (+) | 1005 | WP_000161234.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| K8Z23_RS27785 (K8Z23_27735) | - | 5400585..5401769 (+) | 1185 | WP_001036332.1 | phosphoglycerate kinase | - |
| K8Z23_RS27790 (K8Z23_27740) | tpiA | 5401802..5402557 (+) | 756 | WP_001231042.1 | triose-phosphate isomerase | - |
| K8Z23_RS27795 (K8Z23_27745) | gpmI | 5402554..5404083 (+) | 1530 | WP_001231141.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| K8Z23_RS27800 (K8Z23_27750) | eno | 5404114..5405409 (+) | 1296 | WP_000103951.1 | phosphopyruvate hydratase | - |
| K8Z23_RS27805 (K8Z23_27755) | - | 5405460..5406410 (-) | 951 | WP_001125040.1 | nucleoside hydrolase | - |
| K8Z23_RS27810 (K8Z23_27760) | - | 5406763..5407131 (+) | 369 | WP_000673222.1 | CidA/LrgA family holin-like protein | - |
| K8Z23_RS27815 (K8Z23_27765) | - | 5407128..5407820 (+) | 693 | WP_000078304.1 | LrgB family protein | - |
| K8Z23_RS27820 (K8Z23_27770) | secG | 5407915..5408148 (+) | 234 | WP_042596553.1 | preprotein translocase subunit SecG | - |
| K8Z23_RS27825 (K8Z23_27775) | estA | 5408310..5409050 (+) | 741 | WP_000761986.1 | carboxylesterase | - |
| K8Z23_RS27830 (K8Z23_27780) | - | 5409112..5410173 (-) | 1062 | WP_042596551.1 | tyrosine-type recombinase/integrase | - |
| K8Z23_RS27840 (K8Z23_27790) | - | 5411157..5412395 (+) | 1239 | WP_042596549.1 | AimR family lysis-lysogeny pheromone receptor | - |
| K8Z23_RS27845 (K8Z23_27795) | - | 5412796..5413140 (-) | 345 | WP_000511081.1 | helix-turn-helix domain-containing protein | - |
| K8Z23_RS27850 (K8Z23_27800) | - | 5413289..5413525 (+) | 237 | WP_000813894.1 | helix-turn-helix transcriptional regulator | - |
| K8Z23_RS27855 (K8Z23_27805) | - | 5413558..5413746 (+) | 189 | WP_042596547.1 | helix-turn-helix transcriptional regulator | - |
| K8Z23_RS31320 | - | 5413770..5413925 (+) | 156 | WP_171840947.1 | DUF6906 family protein | - |
| K8Z23_RS27860 (K8Z23_27810) | - | 5413964..5414788 (+) | 825 | WP_042596545.1 | ORF6C domain-containing protein | - |
| K8Z23_RS27865 (K8Z23_27815) | - | 5414952..5415266 (+) | 315 | WP_042596543.1 | hypothetical protein | - |
| K8Z23_RS27870 (K8Z23_27820) | - | 5415541..5416188 (+) | 648 | WP_042596541.1 | sigma-70 family RNA polymerase sigma factor | - |
| K8Z23_RS27875 (K8Z23_27825) | - | 5416434..5417450 (+) | 1017 | WP_042596539.1 | hypothetical protein | - |
| K8Z23_RS27880 (K8Z23_27830) | - | 5417413..5418225 (+) | 813 | WP_000705175.1 | DnaA ATPase domain-containing protein | - |
| K8Z23_RS27885 (K8Z23_27835) | - | 5418267..5418533 (+) | 267 | WP_000436950.1 | hypothetical protein | - |
| K8Z23_RS27890 (K8Z23_27840) | - | 5418605..5418769 (+) | 165 | WP_000817807.1 | DUF3954 domain-containing protein | - |
| K8Z23_RS27895 (K8Z23_27845) | - | 5418787..5419002 (+) | 216 | WP_042596537.1 | Thoeris anti-defense Tad2 family protein | - |
| K8Z23_RS27900 (K8Z23_27850) | - | 5418999..5419298 (-) | 300 | WP_000705116.1 | hypothetical protein | - |
| K8Z23_RS27905 (K8Z23_27855) | - | 5419449..5419748 (+) | 300 | WP_042596535.1 | hypothetical protein | - |
| K8Z23_RS27910 (K8Z23_27860) | - | 5420102..5420500 (+) | 399 | WP_000404183.1 | hypothetical protein | - |
| K8Z23_RS31010 | - | 5421057..5421185 (+) | 129 | WP_267132536.1 | hypothetical protein | - |
| K8Z23_RS27915 (K8Z23_27865) | - | 5421918..5422199 (+) | 282 | WP_000965619.1 | hypothetical protein | - |
| K8Z23_RS27920 (K8Z23_27870) | - | 5422365..5422529 (+) | 165 | WP_000866514.1 | hypothetical protein | - |
| K8Z23_RS27925 (K8Z23_27875) | - | 5422557..5423042 (+) | 486 | WP_042596531.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| K8Z23_RS27930 (K8Z23_27880) | - | 5423039..5423581 (+) | 543 | WP_042596530.1 | site-specific integrase | - |
| K8Z23_RS27935 (K8Z23_27885) | - | 5423791..5424033 (+) | 243 | WP_000333056.1 | hypothetical protein | - |
| K8Z23_RS27940 (K8Z23_27890) | - | 5424436..5424723 (+) | 288 | WP_000017440.1 | hypothetical protein | - |
| K8Z23_RS27945 (K8Z23_27895) | - | 5424760..5424987 (+) | 228 | WP_044798179.1 | hypothetical protein | - |
| K8Z23_RS27950 (K8Z23_27900) | - | 5425033..5425230 (+) | 198 | WP_044798178.1 | hypothetical protein | - |
| K8Z23_RS27955 (K8Z23_27905) | - | 5425247..5425486 (+) | 240 | WP_044798177.1 | hypothetical protein | - |
| K8Z23_RS27960 (K8Z23_27910) | - | 5425503..5425715 (+) | 213 | WP_000773601.1 | hypothetical protein | - |
| K8Z23_RS27965 (K8Z23_27915) | - | 5425850..5426104 (+) | 255 | WP_042597896.1 | hypothetical protein | - |
| K8Z23_RS27970 (K8Z23_27920) | - | 5426094..5426492 (+) | 399 | WP_044798176.1 | HNH endonuclease | - |
| K8Z23_RS27975 (K8Z23_27925) | - | 5426601..5427104 (+) | 504 | WP_000233388.1 | phage terminase small subunit P27 family | - |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21419.67 Da Isoelectric Point: 5.0423
>NTDB_id=604762 K8Z23_RS27680 WP_001049162.1 5382906..5383487(-) (clpP) [Bacillus thuringiensis strain NB-176]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=604762 K8Z23_RS27680 WP_001049162.1 5382906..5383487(-) (clpP) [Bacillus thuringiensis strain NB-176]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGTGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGTGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
90.104 |
99.482 |
0.896 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |