Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | K8Z41_RS28090 | Genome accession | NZ_CP083116 |
| Coordinates | 5439666..5440247 (-) | Length | 193 a.a. |
| NCBI ID | WP_001049162.1 | Uniprot ID | A0A9W5QPC2 |
| Organism | Bacillus thuringiensis strain SA11 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5439666..5488895 | 5439666..5440247 | within | 0 |
Gene organization within MGE regions
Location: 5439666..5488895
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K8Z41_RS28090 (K8Z41_28040) | clpP | 5439666..5440247 (-) | 582 | WP_001049162.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
| K8Z41_RS28095 (K8Z41_28045) | - | 5440488..5441357 (-) | 870 | WP_000018924.1 | DUF421 domain-containing protein | - |
| K8Z41_RS28100 (K8Z41_28050) | - | 5441378..5441584 (-) | 207 | WP_000215909.1 | DUF1657 domain-containing protein | - |
| K8Z41_RS28105 (K8Z41_28055) | spoVAE | 5441596..5441946 (-) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| K8Z41_RS28110 (K8Z41_28060) | spoVAD | 5441943..5442959 (-) | 1017 | WP_000938972.1 | stage V sporulation protein AD | - |
| K8Z41_RS28115 (K8Z41_28065) | spoVAC | 5442960..5443436 (-) | 477 | WP_000095408.1 | stage V sporulation protein AC | - |
| K8Z41_RS28120 (K8Z41_28070) | - | 5443466..5443954 (-) | 489 | WP_001226064.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| K8Z41_RS28125 (K8Z41_28075) | - | 5444048..5444254 (-) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| K8Z41_RS28135 (K8Z41_28085) | - | 5444669..5445805 (-) | 1137 | WP_000135757.1 | tyrosine-type recombinase/integrase | - |
| K8Z41_RS28140 (K8Z41_28090) | - | 5445836..5446303 (-) | 468 | WP_001037137.1 | hypothetical protein | - |
| K8Z41_RS28145 (K8Z41_28095) | - | 5446314..5446706 (-) | 393 | WP_002133807.1 | helix-turn-helix transcriptional regulator | - |
| K8Z41_RS28150 (K8Z41_28100) | - | 5446871..5447101 (+) | 231 | WP_000216290.1 | helix-turn-helix transcriptional regulator | - |
| K8Z41_RS28155 (K8Z41_28105) | - | 5447137..5447370 (+) | 234 | WP_000711864.1 | DUF771 domain-containing protein | - |
| K8Z41_RS28160 (K8Z41_28110) | - | 5447554..5447709 (+) | 156 | WP_000788383.1 | hypothetical protein | - |
| K8Z41_RS28165 (K8Z41_28115) | - | 5447724..5448479 (+) | 756 | WP_001016247.1 | phage regulatory protein | - |
| K8Z41_RS28170 (K8Z41_28120) | - | 5448491..5448679 (+) | 189 | WP_001187283.1 | hypothetical protein | - |
| K8Z41_RS28175 (K8Z41_28125) | - | 5448706..5449149 (+) | 444 | WP_000453495.1 | hypothetical protein | - |
| K8Z41_RS28180 (K8Z41_28130) | - | 5449167..5449880 (+) | 714 | WP_015382506.1 | hypothetical protein | - |
| K8Z41_RS28185 (K8Z41_28135) | - | 5449880..5450095 (+) | 216 | WP_000355713.1 | hypothetical protein | - |
| K8Z41_RS28190 (K8Z41_28140) | - | 5450025..5450366 (+) | 342 | WP_002133909.1 | hypothetical protein | - |
| K8Z41_RS28195 (K8Z41_28145) | - | 5450460..5451413 (+) | 954 | WP_000510889.1 | DnaD domain protein | - |
| K8Z41_RS28200 (K8Z41_28150) | - | 5451425..5451904 (+) | 480 | WP_000933908.1 | hypothetical protein | - |
| K8Z41_RS28205 (K8Z41_28155) | - | 5451897..5452127 (+) | 231 | WP_000139235.1 | hypothetical protein | - |
| K8Z41_RS28210 (K8Z41_28160) | - | 5452151..5452708 (+) | 558 | WP_001245738.1 | hypothetical protein | - |
| K8Z41_RS28215 (K8Z41_28165) | - | 5452747..5453181 (+) | 435 | WP_000775809.1 | hypothetical protein | - |
| K8Z41_RS28220 (K8Z41_28170) | - | 5453240..5453530 (+) | 291 | WP_001268031.1 | hypothetical protein | - |
| K8Z41_RS28225 (K8Z41_28175) | - | 5453535..5453675 (+) | 141 | WP_000492043.1 | hypothetical protein | - |
| K8Z41_RS28235 (K8Z41_28180) | - | 5453677..5454470 (+) | 794 | Protein_5510 | prohibitin family protein | - |
| K8Z41_RS28240 (K8Z41_28185) | - | 5454553..5454807 (+) | 255 | WP_000520932.1 | hypothetical protein | - |
| K8Z41_RS28245 (K8Z41_28190) | - | 5454843..5455538 (+) | 696 | WP_000858114.1 | hypothetical protein | - |
| K8Z41_RS28250 (K8Z41_28195) | - | 5455583..5455894 (+) | 312 | WP_000590881.1 | hypothetical protein | - |
| K8Z41_RS28255 (K8Z41_28200) | recU | 5455930..5456457 (+) | 528 | WP_000540086.1 | Holliday junction resolvase RecU | - |
| K8Z41_RS28260 (K8Z41_28205) | - | 5456454..5456780 (+) | 327 | WP_015670520.1 | hypothetical protein | - |
| K8Z41_RS28265 (K8Z41_28210) | - | 5456818..5457219 (+) | 402 | WP_003308641.1 | hypothetical protein | - |
| K8Z41_RS28270 (K8Z41_28215) | - | 5457603..5458022 (-) | 420 | WP_000711194.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| K8Z41_RS28275 (K8Z41_28220) | - | 5458074..5458262 (-) | 189 | WP_306460290.1 | type II toxin-antitoxin system HicA family toxin | - |
| K8Z41_RS28280 (K8Z41_28225) | - | 5458436..5458660 (+) | 225 | WP_000650576.1 | hypothetical protein | - |
| K8Z41_RS28285 (K8Z41_28230) | - | 5458674..5458877 (+) | 204 | WP_000343502.1 | hypothetical protein | - |
| K8Z41_RS28290 (K8Z41_28235) | - | 5458883..5459317 (+) | 435 | WP_001002014.1 | hypothetical protein | - |
| K8Z41_RS28295 (K8Z41_28240) | - | 5459386..5459595 (+) | 210 | WP_001177575.1 | hypothetical protein | - |
| K8Z41_RS28300 (K8Z41_28245) | - | 5459602..5459859 (+) | 258 | WP_000378699.1 | hypothetical protein | - |
| K8Z41_RS28305 (K8Z41_28250) | - | 5459850..5460224 (+) | 375 | WP_001177571.1 | hypothetical protein | - |
| K8Z41_RS28310 (K8Z41_28255) | - | 5460190..5460525 (+) | 336 | WP_000666398.1 | HNH endonuclease | - |
| K8Z41_RS28315 (K8Z41_28260) | - | 5460650..5460961 (+) | 312 | WP_000301150.1 | P27 family phage terminase small subunit | - |
| K8Z41_RS28320 (K8Z41_28265) | - | 5460958..5462643 (+) | 1686 | WP_000595321.1 | terminase large subunit | - |
| K8Z41_RS28325 (K8Z41_28270) | - | 5462664..5463815 (+) | 1152 | WP_000118683.1 | phage portal protein | - |
| K8Z41_RS28330 (K8Z41_28275) | - | 5463805..5464530 (+) | 726 | WP_000791073.1 | head maturation protease, ClpP-related | - |
| K8Z41_RS28335 (K8Z41_28280) | - | 5464581..5465723 (+) | 1143 | WP_086401347.1 | phage major capsid protein | - |
| K8Z41_RS28340 (K8Z41_28285) | - | 5465736..5466029 (+) | 294 | WP_000361981.1 | hypothetical protein | - |
| K8Z41_RS28345 (K8Z41_28290) | - | 5466031..5466381 (+) | 351 | WP_001247297.1 | phage head closure protein | - |
| K8Z41_RS28350 (K8Z41_28295) | - | 5466383..5466727 (+) | 345 | WP_000997537.1 | HK97 gp10 family phage protein | - |
| K8Z41_RS28355 (K8Z41_28300) | - | 5466724..5467059 (+) | 336 | WP_000219080.1 | hypothetical protein | - |
| K8Z41_RS28360 (K8Z41_28305) | - | 5467060..5467653 (+) | 594 | WP_001004920.1 | major tail protein | - |
| K8Z41_RS28365 (K8Z41_28310) | - | 5467660..5468022 (+) | 363 | WP_000415931.1 | hypothetical protein | - |
| K8Z41_RS28370 (K8Z41_28315) | - | 5468253..5469488 (+) | 1236 | WP_000897021.1 | hypothetical protein | - |
| K8Z41_RS28375 (K8Z41_28320) | - | 5469766..5472147 (+) | 2382 | WP_002133928.1 | hypothetical protein | - |
| K8Z41_RS28380 (K8Z41_28325) | - | 5472189..5473658 (+) | 1470 | WP_015382503.1 | distal tail protein Dit | - |
| K8Z41_RS28385 (K8Z41_28330) | - | 5473655..5478037 (+) | 4383 | WP_015382502.1 | phage tail spike protein | - |
| K8Z41_RS28390 (K8Z41_28335) | - | 5478054..5478425 (+) | 372 | WP_016090170.1 | hypothetical protein | - |
| K8Z41_RS28395 (K8Z41_28340) | - | 5478546..5479739 (-) | 1194 | WP_000499524.1 | IS110 family transposase | - |
| K8Z41_RS28400 (K8Z41_28345) | - | 5480034..5480477 (+) | 444 | WP_042991251.1 | phage holin family protein | - |
| K8Z41_RS28405 (K8Z41_28350) | - | 5480539..5481732 (-) | 1194 | WP_000499524.1 | IS110 family transposase | - |
| K8Z41_RS28410 (K8Z41_28355) | - | 5482030..5482965 (+) | 936 | WP_000405783.1 | N-acetylmuramoyl-L-alanine amidase | - |
| K8Z41_RS28415 (K8Z41_28360) | - | 5483169..5484284 (+) | 1116 | WP_000993515.1 | Rap family tetratricopeptide repeat protein | - |
| K8Z41_RS28420 (K8Z41_28365) | - | 5484284..5484502 (+) | 219 | WP_000734384.1 | hypothetical protein | - |
| K8Z41_RS28425 (K8Z41_28370) | - | 5484681..5485247 (-) | 567 | WP_000742864.1 | hypothetical protein | - |
| K8Z41_RS28430 (K8Z41_28375) | - | 5485391..5485609 (+) | 219 | WP_001016121.1 | hypothetical protein | - |
| K8Z41_RS28435 (K8Z41_28380) | - | 5485634..5485927 (+) | 294 | WP_001273481.1 | YolD-like family protein | - |
| K8Z41_RS28440 (K8Z41_28385) | - | 5485943..5486770 (-) | 828 | WP_000412580.1 | helix-turn-helix domain-containing protein | - |
| K8Z41_RS28445 (K8Z41_28390) | rpoN | 5487333..5488640 (+) | 1308 | WP_000647955.1 | RNA polymerase factor sigma-54 | - |
| K8Z41_RS28450 (K8Z41_28395) | - | 5488650..5488895 (+) | 246 | WP_000869730.1 | glutaredoxin family protein | - |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21419.67 Da Isoelectric Point: 5.0423
>NTDB_id=604715 K8Z41_RS28090 WP_001049162.1 5439666..5440247(-) (clpP) [Bacillus thuringiensis strain SA11]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=604715 K8Z41_RS28090 WP_001049162.1 5439666..5440247(-) (clpP) [Bacillus thuringiensis strain SA11]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
90.104 |
99.482 |
0.896 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |