NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	JSY00_RS06965	Genome accession	NZ_CP082778
Coordinates	1413584..1414174 (-)	Length	196 a.a.
NCBI ID	WP_002937303.1	Uniprot ID	A0A0K2E545
Organism	Streptococcus suis strain ID32098
Function	degradation of ComX (predicted from homology) Competence regulation

Genomic Context

Location: 1408584..1419174

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JSY00_RS06940 (JSY00_06940)	-	1409082..1409846 (-)	765	WP_002937291.1	ABC transporter ATP-binding protein	-
JSY00_RS06945 (JSY00_06945)	-	1409846..1410793 (-)	948	WP_002937293.1	branched-chain amino acid ABC transporter permease	-
JSY00_RS06950 (JSY00_06950)	-	1410796..1411683 (-)	888	WP_004298925.1	branched-chain amino acid ABC transporter permease	-
JSY00_RS06955 (JSY00_06955)	-	1411884..1413053 (-)	1170	WP_024386220.1	ABC transporter substrate-binding protein	-
JSY00_RS06960 (JSY00_06960)	-	1413185..1413457 (-)	273	WP_024381609.1	YlbG family protein	-
JSY00_RS06965 (JSY00_06965)	clpP	1413584..1414174 (-)	591	WP_002937303.1	ATP-dependent Clp protease proteolytic subunit	Regulator
JSY00_RS06970 (JSY00_06970)	upp	1414291..1414920 (-)	630	WP_012027487.1	uracil phosphoribosyltransferase	-
JSY00_RS06975 (JSY00_06975)	-	1415000..1416616 (-)	1617	WP_044680065.1	alpha-glucosidase	-
JSY00_RS06980 (JSY00_06980)	gtfA	1416689..1418137 (-)	1449	WP_024410943.1	sucrose phosphorylase	-
JSY00_RS06985 (JSY00_06985)	-	1418207..1419037 (-)	831	WP_002937312.1	carbohydrate ABC transporter permease	-

Sequence

Protein

Download Length: 196 a.a. Molecular weight: 21494.74 Da Isoelectric Point: 5.7110

                                >NTDB_id=602107 JSY00_RS06965 WP_002937303.1 1413584..1414174(-) (clpP) [Streptococcus suis strain ID32098]

MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDPTKDIYLYVNTPGGSVSAGLAIVDTMN

FIKADVQTIVMGTAASMGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNKLEKILADNSGK

TVKQIHKDAERDYWMSAEETLAYGFIDQIMDNTKVK

Nucleotide

Download Length: 591 bp

                                >NTDB_id=602107 JSY00_RS06965 WP_002937303.1 1413584..1414174(-) (clpP) [Streptococcus suis strain ID32098]

ATGATTCCAGTAGTTATTGAACAAACTAGCCGTGGTGAGCGTTCTTATGATATTTACTCACGCCTTTTGAAAGACCGCAT

TATCATGTTGACAGGACCAGTTGAGGACAACATGGCAAACTCTATCATTGCCCAGTTGCTTTTCCTTGATGCCCAAGACC

CTACAAAGGATATTTACCTCTATGTTAATACGCCAGGAGGATCGGTGTCAGCAGGTCTTGCTATTGTAGATACTATGAAT

TTTATCAAGGCTGATGTGCAAACCATTGTTATGGGAACAGCGGCCAGTATGGGTACAATTATCGCTTCAAGCGGTGCCAA

AGGCAAACGTTTCATGTTGCCAAATGCGGAATACATGATTCACCAACCAATGGGTGGAACAGGTGGCGGTACACAGCAAA

CAGATATGGCTATTGCAGCAGAACACCTATTAAAAACACGTAATAAGCTAGAAAAAATCTTGGCAGACAACTCAGGTAAG

ACAGTCAAGCAAATCCACAAGGATGCGGAACGCGATTACTGGATGTCAGCTGAAGAAACCTTGGCTTACGGATTTATTGA

CCAGATTATGGACAATACAAAAGTCAAATAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(11-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0K2E545

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Streptococcus pyogenes JRS4	92.347	100	0.923
clpP	Streptococcus pyogenes MGAS315	92.347	100	0.923
clpP	Streptococcus mutans UA159	90.306	100	0.903
clpP	Streptococcus pneumoniae R6	88.776	100	0.888
clpP	Streptococcus pneumoniae Rx1	88.776	100	0.888
clpP	Streptococcus pneumoniae D39	88.776	100	0.888
clpP	Streptococcus pneumoniae TIGR4	88.776	100	0.888
clpP	Streptococcus thermophilus LMG 18311	88.776	100	0.888
clpP	Streptococcus thermophilus LMD-9	88.776	100	0.888
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	84.184	100	0.842
clpP	Lactococcus lactis subsp. cremoris KW2	83.673	100	0.837
clpP	Bacillus subtilis subsp. subtilis str. 168	58.163	100	0.582
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	58.549	98.469	0.577

Detailed information NTG0602107