Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | L897_RS05655 | Genome accession | NC_021807 |
| Coordinates | 1130407..1130589 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes HSC5 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1130407..1166779 | 1130407..1130589 | within | 0 |
Gene organization within MGE regions
Location: 1130407..1166779
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L897_RS05655 (L897_05805) | prx | 1130407..1130589 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| L897_RS05660 (L897_05810) | sda3 | 1130827..1131627 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| L897_RS05665 (L897_05815) | - | 1131898..1132332 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| L897_RS05670 (L897_05820) | - | 1132402..1133607 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| L897_RS05680 (L897_05830) | - | 1133723..1133950 (-) | 228 | WP_003058873.1 | phage holin | - |
| L897_RS05685 (L897_05835) | - | 1133947..1134222 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| L897_RS05690 (L897_05840) | - | 1134232..1134849 (-) | 618 | WP_020833519.1 | DUF1366 domain-containing protein | - |
| L897_RS05695 (L897_05845) | - | 1134852..1135283 (-) | 432 | WP_020837375.1 | DUF1617 family protein | - |
| L897_RS05700 (L897_05850) | - | 1135295..1137079 (-) | 1785 | WP_020837377.1 | gp58-like family protein | - |
| L897_RS05705 (L897_05855) | - | 1137094..1138092 (-) | 999 | WP_020837379.1 | hyaluronoglucosaminidase | - |
| L897_RS05710 (L897_05860) | - | 1138092..1140050 (-) | 1959 | WP_010922451.1 | phage tail spike protein | - |
| L897_RS05715 (L897_05865) | - | 1140047..1140742 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| L897_RS05720 (L897_05870) | - | 1140739..1143096 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| L897_RS05725 (L897_05875) | - | 1143096..1143467 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| L897_RS05730 (L897_05880) | - | 1143482..1143745 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| L897_RS05735 (L897_05885) | - | 1143756..1144349 (-) | 594 | WP_010922456.1 | tail protein | - |
| L897_RS05740 (L897_05890) | - | 1144361..1144696 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| L897_RS05745 (L897_05895) | - | 1144697..1144933 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| L897_RS05750 (L897_05900) | - | 1144926..1145264 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| L897_RS05755 (L897_05905) | - | 1145224..1145646 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| L897_RS05760 (L897_05910) | - | 1145656..1145856 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| L897_RS05765 (L897_05915) | - | 1145856..1146767 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| L897_RS05770 (L897_05920) | - | 1146792..1147253 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| L897_RS05775 (L897_05925) | - | 1147334..1148749 (-) | 1416 | WP_011285619.1 | terminase | - |
| L897_RS05780 (L897_05930) | - | 1148859..1149125 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| L897_RS05785 (L897_05935) | - | 1149118..1149297 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| L897_RS05790 (L897_05940) | - | 1149347..1149571 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| L897_RS05795 (L897_05945) | - | 1149577..1151070 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| L897_RS05800 (L897_05950) | - | 1151063..1152331 (-) | 1269 | WP_020837398.1 | phage portal protein | - |
| L897_RS05805 (L897_05955) | - | 1152328..1152684 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| L897_RS05810 (L897_05960) | - | 1152833..1153177 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| L897_RS05815 (L897_05965) | - | 1153286..1153705 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| L897_RS05820 (L897_05970) | - | 1153973..1154608 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| L897_RS05825 (L897_05975) | - | 1154610..1154879 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| L897_RS05830 (L897_05980) | - | 1154963..1155475 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| L897_RS05835 (L897_05985) | - | 1155472..1155813 (-) | 342 | WP_020837403.1 | hypothetical protein | - |
| L897_RS09695 (L897_05990) | - | 1155991..1156158 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| L897_RS05840 (L897_05995) | - | 1156168..1156965 (-) | 798 | WP_020837407.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| L897_RS05845 (L897_06000) | - | 1156962..1157891 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| L897_RS05850 (L897_06005) | - | 1157894..1158223 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| L897_RS05855 (L897_06010) | - | 1158279..1158485 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| L897_RS09600 (L897_06015) | - | 1158494..1158634 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| L897_RS05860 (L897_06020) | - | 1158631..1158864 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| L897_RS05865 (L897_06025) | - | 1158845..1159234 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| L897_RS09840 (L897_06030) | - | 1159379..1159618 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| L897_RS05875 (L897_06035) | - | 1159718..1159903 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| L897_RS05880 (L897_06040) | - | 1159905..1160216 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| L897_RS05885 (L897_06045) | - | 1160294..1160479 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| L897_RS05890 (L897_06050) | - | 1160646..1160885 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| L897_RS05895 (L897_06060) | - | 1161027..1161833 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| L897_RS09330 | - | 1161768..1162034 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| L897_RS05900 (L897_06065) | - | 1162066..1162782 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| L897_RS05905 (L897_06070) | - | 1162794..1162985 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| L897_RS09335 (L897_06080) | - | 1163621..1163716 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| L897_RS05910 (L897_06085) | - | 1164139..1164486 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| L897_RS05915 (L897_06090) | - | 1164490..1164870 (+) | 381 | WP_020837423.1 | ImmA/IrrE family metallo-endopeptidase | - |
| L897_RS05920 (L897_06095) | - | 1164882..1165148 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| L897_RS05925 (L897_06100) | - | 1165272..1166414 (+) | 1143 | WP_020837425.1 | site-specific integrase | - |
| L897_RS05930 (L897_06105) | - | 1166504..1166779 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=59937 L897_RS05655 WP_011017964.1 1130407..1130589(-) (prx) [Streptococcus pyogenes HSC5]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=59937 L897_RS05655 WP_011017964.1 1130407..1130589(-) (prx) [Streptococcus pyogenes HSC5]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |