NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	K5J94_RS04660	Genome accession	NZ_CP081502
Coordinates	971634..972224 (+)	Length	196 a.a.
NCBI ID	WP_159544977.1	Uniprot ID	-
Organism	Streptococcus halichoeri strain Shali_VAS-CPH
Function	degradation of ComX (predicted from homology) Competence regulation

Genomic Context

Location: 966634..977224

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
K5J94_RS04645	-	967393..968847 (-)	1455	WP_221913674.1	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase	-
K5J94_RS04650	-	968936..970573 (+)	1638	WP_159592561.1	polysaccharide biosynthesis protein	-
K5J94_RS04655	upp	970813..971442 (+)	630	WP_159544975.1	uracil phosphoribosyltransferase	-
K5J94_RS04660	clpP	971634..972224 (+)	591	WP_159544977.1	ATP-dependent Clp protease proteolytic subunit	Regulator
K5J94_RS04665	-	972471..972770 (+)	300	Protein_869	YlbF family regulator	-
K5J94_RS04670	-	972802..973080 (+)	279	WP_159544981.1	YlbG family protein	-
K5J94_RS04675	tmk	973459..974112 (+)	654	WP_221913676.1	dTMP kinase	-
K5J94_RS04680	-	974112..974987 (+)	876	WP_159564927.1	DNA polymerase III subunit delta'	-
K5J94_RS04685	ricT	974984..975772 (+)	789	WP_221913678.1	regulatory iron-sulfur-containing complex subunit RicT	-
K5J94_RS04690	yabA	975765..976094 (+)	330	WP_159544989.1	DNA replication initiation control protein YabA	-
K5J94_RS04695	rsmI	976099..976971 (+)	873	WP_159564931.1	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	-

Sequence

Protein

Download Length: 196 a.a. Molecular weight: 21598.76 Da Isoelectric Point: 5.0281

                                >NTDB_id=597062 K5J94_RS04660 WP_159544977.1 971634..972224(+) (clpP) [Streptococcus halichoeri strain Shali_VAS-CPH]

MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNLANSIIAQLLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMN

FIKSDVQTIVMGMAASMGTVIASSGTKGKRFMLPNAEYMIHQPMGGTGGGTQQSDMAIAAEHLLKTRHRLEKILAQNSGK

TIKQIHKDAERDNWMTAEETLAYGFIDEIMENNELV

Nucleotide

Download Length: 591 bp

                                >NTDB_id=597062 K5J94_RS04660 WP_159544977.1 971634..972224(+) (clpP) [Streptococcus halichoeri strain Shali_VAS-CPH]

ATGATTCCTGTTGTTATTGAACAAACAAGTCGTGGCGAACGCTCTTACGACATTTATTCGCGTTTATTAAAAGACCGTAT

CATTATGTTGACTGGTCCGGTCGAAGACAATCTTGCTAACAGTATTATCGCGCAGCTATTATTCTTGGATGCACAAGATA

ATACCAAAGATATTTACCTTTACGTCAATACGCCTGGTGGCTCTGTCTCGGCTGGTTTAGCGATTGTTGATACGATGAAT

TTCATCAAATCAGACGTGCAAACGATTGTTATGGGGATGGCTGCCTCAATGGGGACAGTCATTGCCTCATCTGGTACAAA

AGGCAAACGCTTCATGTTGCCTAATGCGGAGTACATGATTCACCAGCCAATGGGTGGCACCGGTGGCGGTACGCAACAAT

CAGACATGGCCATTGCTGCTGAGCATCTCTTGAAAACGCGTCATCGTTTGGAAAAAATCTTGGCCCAAAATTCTGGCAAG

ACCATCAAACAAATTCACAAAGATGCTGAGCGTGATAATTGGATGACGGCAGAAGAAACGCTGGCTTATGGCTTTATTGA

TGAAATTATGGAAAATAACGAGCTAGTCTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(11-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Streptococcus pyogenes MGAS315	96.41	99.49	0.959
clpP	Streptococcus pyogenes JRS4	96.41	99.49	0.959
clpP	Streptococcus mutans UA159	91.795	99.49	0.913
clpP	Streptococcus thermophilus LMD-9	90.256	99.49	0.898
clpP	Streptococcus thermophilus LMG 18311	90.256	99.49	0.898
clpP	Streptococcus pneumoniae Rx1	89.231	99.49	0.888
clpP	Streptococcus pneumoniae D39	89.231	99.49	0.888
clpP	Streptococcus pneumoniae R6	89.231	99.49	0.888
clpP	Streptococcus pneumoniae TIGR4	89.231	99.49	0.888
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	86.667	99.49	0.862
clpP	Lactococcus lactis subsp. cremoris KW2	86.154	99.49	0.857
clpP	Bacillus subtilis subsp. subtilis str. 168	57.216	98.98	0.566
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	56.995	98.469	0.561

Detailed information NTG0597062