Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KWH15_RS09955 | Genome accession | NZ_CP078521 |
| Coordinates | 2013437..2013907 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain ATCC 29213 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1983091..2034922 | 2013437..2013907 | within | 0 |
Gene organization within MGE regions
Location: 1983091..2034922
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWH15_RS09735 (KWH15_09735) | scn | 1983091..1983441 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| KWH15_RS09740 (KWH15_09740) | - | 1984127..1984576 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KWH15_RS09745 (KWH15_09745) | - | 1984671..1985006 (-) | 336 | Protein_1886 | SH3 domain-containing protein | - |
| KWH15_RS09750 (KWH15_09750) | sak | 1985656..1986147 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| KWH15_RS09755 (KWH15_09755) | - | 1986338..1987093 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KWH15_RS09760 (KWH15_09760) | - | 1987105..1987359 (-) | 255 | WP_000611512.1 | phage holin | - |
| KWH15_RS09765 (KWH15_09765) | - | 1987411..1987518 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| KWH15_RS09770 (KWH15_09770) | pepG1 | 1987571..1987705 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| KWH15_RS09775 (KWH15_09775) | sea | 1987856..1988629 (-) | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| KWH15_RS09780 (KWH15_09780) | - | 1989050..1989424 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| KWH15_RS09785 (KWH15_09785) | - | 1989480..1989767 (-) | 288 | WP_001040259.1 | hypothetical protein | - |
| KWH15_RS09790 (KWH15_09790) | - | 1989814..1989966 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| KWH15_RS09795 (KWH15_09795) | - | 1989956..1993741 (-) | 3786 | WP_000582190.1 | phage tail spike protein | - |
| KWH15_RS09800 (KWH15_09800) | - | 1993757..1995241 (-) | 1485 | WP_000567413.1 | phage tail domain-containing protein | - |
| KWH15_RS09805 (KWH15_09805) | - | 1995238..1999767 (-) | 4530 | Protein_1898 | phage tail tape measure protein | - |
| KWH15_RS09810 (KWH15_09810) | - | 1999824..1999961 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| KWH15_RS09815 (KWH15_09815) | - | 2000012..2000362 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| KWH15_RS09820 (KWH15_09820) | - | 2000412..2000642 (-) | 231 | Protein_1901 | Ig-like domain-containing protein | - |
| KWH15_RS09825 (KWH15_09825) | - | 2000678..2001322 (-) | 645 | WP_000268735.1 | major tail protein | - |
| KWH15_RS09830 (KWH15_09830) | - | 2001323..2001730 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| KWH15_RS09835 (KWH15_09835) | - | 2001727..2002131 (-) | 405 | WP_031768935.1 | HK97 gp10 family phage protein | - |
| KWH15_RS09840 (KWH15_09840) | - | 2002128..2002490 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| KWH15_RS09845 (KWH15_09845) | - | 2002474..2002758 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| KWH15_RS09850 (KWH15_09850) | - | 2002748..2003031 (-) | 284 | Protein_1907 | hypothetical protein | - |
| KWH15_RS09855 (KWH15_09855) | - | 2003051..2004196 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| KWH15_RS09860 (KWH15_09860) | - | 2004220..2004957 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| KWH15_RS09865 (KWH15_09865) | - | 2004941..2006128 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| KWH15_RS09870 (KWH15_09870) | - | 2006144..2007805 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| KWH15_RS09875 (KWH15_09875) | - | 2007802..2008146 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| KWH15_RS09880 (KWH15_09880) | - | 2008276..2008575 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| KWH15_RS09885 (KWH15_09885) | - | 2008807..2009223 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| KWH15_RS09890 (KWH15_09890) | - | 2009251..2009451 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| KWH15_RS09895 (KWH15_09895) | - | 2009451..2009600 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| KWH15_RS09900 (KWH15_09900) | - | 2009597..2009983 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| KWH15_RS09905 (KWH15_09905) | - | 2009980..2010186 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| KWH15_RS09910 (KWH15_09910) | - | 2010223..2010765 (-) | 543 | WP_000185659.1 | dUTP pyrophosphatase | - |
| KWH15_RS09915 (KWH15_09915) | - | 2010758..2010940 (-) | 183 | WP_000028422.1 | hypothetical protein | - |
| KWH15_RS09920 (KWH15_09920) | - | 2010930..2011181 (-) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| KWH15_RS09925 (KWH15_09925) | - | 2011174..2011341 (-) | 168 | WP_001624242.1 | hypothetical protein | - |
| KWH15_RS09930 (KWH15_09930) | - | 2011353..2011595 (-) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| KWH15_RS09935 (KWH15_09935) | - | 2011599..2011967 (-) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| KWH15_RS09940 (KWH15_09940) | - | 2012035..2012301 (-) | 267 | Protein_1925 | RusA family crossover junction endodeoxyribonuclease | - |
| KWH15_RS09945 (KWH15_09945) | - | 2012298..2012516 (-) | 219 | WP_000338531.1 | hypothetical protein | - |
| KWH15_RS09950 (KWH15_09950) | - | 2012523..2013407 (-) | 885 | WP_000148316.1 | DnaD domain protein | - |
| KWH15_RS09955 (KWH15_09955) | ssbA | 2013437..2013907 (-) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| KWH15_RS09960 (KWH15_09960) | - | 2013908..2014525 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| KWH15_RS09965 (KWH15_09965) | - | 2014606..2015526 (-) | 921 | WP_000138472.1 | recombinase RecT | - |
| KWH15_RS09970 (KWH15_09970) | - | 2015528..2017471 (-) | 1944 | WP_000700577.1 | AAA family ATPase | - |
| KWH15_RS09975 (KWH15_09975) | - | 2017480..2017743 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| KWH15_RS09980 (KWH15_09980) | - | 2017752..2018012 (-) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| KWH15_RS09985 (KWH15_09985) | - | 2017993..2018319 (-) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| KWH15_RS09990 (KWH15_09990) | - | 2018414..2018575 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| KWH15_RS09995 (KWH15_09995) | - | 2018572..2018892 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| KWH15_RS10000 (KWH15_10000) | - | 2018951..2019583 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| KWH15_RS10005 (KWH15_10005) | - | 2019598..2019738 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| KWH15_RS10010 (KWH15_10010) | - | 2019769..2019966 (-) | 198 | WP_001148855.1 | hypothetical protein | - |
| KWH15_RS10015 (KWH15_10015) | - | 2019982..2020734 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| KWH15_RS10020 (KWH15_10020) | - | 2020785..2021114 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| KWH15_RS10025 (KWH15_10025) | - | 2021103..2021318 (-) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| KWH15_RS10030 (KWH15_10030) | - | 2021334..2021597 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| KWH15_RS10035 (KWH15_10035) | - | 2021594..2021767 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| KWH15_RS10040 (KWH15_10040) | - | 2021730..2022443 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| KWH15_RS10045 (KWH15_10045) | - | 2022459..2023391 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| KWH15_RS10050 (KWH15_10050) | - | 2023397..2023738 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| KWH15_RS10055 (KWH15_10055) | - | 2023942..2024124 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| KWH15_RS10060 (KWH15_10060) | - | 2024224..2024688 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| KWH15_RS10065 (KWH15_10065) | - | 2024747..2025784 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| KWH15_RS10070 (KWH15_10070) | sph | 2025835..2026665 (+) | 831 | Protein_1951 | sphingomyelin phosphodiesterase | - |
| KWH15_RS10075 (KWH15_10075) | lukG | 2026903..2027919 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| KWH15_RS10080 (KWH15_10080) | lukH | 2027941..2028996 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| KWH15_RS10085 (KWH15_10085) | - | 2029432..2030655 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| KWH15_RS10090 (KWH15_10090) | - | 2031099..2032406 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| KWH15_RS10095 (KWH15_10095) | groL | 2032946..2034562 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| KWH15_RS10100 (KWH15_10100) | groES | 2034638..2034922 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=587599 KWH15_RS09955 WP_000934764.1 2013437..2013907(-) (ssbA) [Staphylococcus aureus strain ATCC 29213]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=587599 KWH15_RS09955 WP_000934764.1 2013437..2013907(-) (ssbA) [Staphylococcus aureus strain ATCC 29213]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |