Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KV238_RS07970 | Genome accession | NZ_CP078012 |
| Coordinates | 1646021..1646209 (+) | Length | 62 a.a. |
| NCBI ID | WP_043983595.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain SEZ_18-036 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1610751..1660778 | 1646021..1646209 | within | 0 |
Gene organization within MGE regions
Location: 1610751..1660778
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KV238_RS07710 (KV238_07705) | - | 1610751..1611839 (-) | 1089 | WP_165619599.1 | site-specific integrase | - |
| KV238_RS07715 (KV238_07710) | - | 1611961..1612635 (-) | 675 | WP_154803906.1 | NYN domain-containing protein | - |
| KV238_RS07720 (KV238_07715) | - | 1612850..1613617 (-) | 768 | WP_165619598.1 | XRE family transcriptional regulator | - |
| KV238_RS07725 (KV238_07720) | - | 1614006..1614164 (+) | 159 | WP_003056201.1 | hypothetical protein | - |
| KV238_RS07730 (KV238_07725) | - | 1614201..1614413 (+) | 213 | WP_165619597.1 | hypothetical protein | - |
| KV238_RS07735 (KV238_07730) | - | 1614372..1614917 (-) | 546 | WP_196820048.1 | hypothetical protein | - |
| KV238_RS07740 (KV238_07735) | - | 1614970..1615176 (+) | 207 | WP_001157159.1 | helix-turn-helix domain-containing protein | - |
| KV238_RS07745 (KV238_07740) | - | 1615216..1615944 (+) | 729 | WP_165619573.1 | phage antirepressor KilAC domain-containing protein | - |
| KV238_RS07750 (KV238_07745) | - | 1616160..1616450 (+) | 291 | WP_037578536.1 | MerR family transcriptional regulator | - |
| KV238_RS07755 (KV238_07750) | - | 1616596..1617408 (+) | 813 | WP_050316935.1 | phage replisome organizer N-terminal domain-containing protein | - |
| KV238_RS07760 (KV238_07755) | - | 1617395..1618177 (+) | 783 | WP_043983621.1 | ATP-binding protein | - |
| KV238_RS07765 (KV238_07760) | - | 1618168..1618305 (+) | 138 | WP_165619574.1 | hypothetical protein | - |
| KV238_RS07770 (KV238_07765) | - | 1618318..1618599 (+) | 282 | WP_165619575.1 | hypothetical protein | - |
| KV238_RS07775 (KV238_07770) | - | 1618599..1618802 (+) | 204 | WP_230923494.1 | hypothetical protein | - |
| KV238_RS07780 (KV238_07775) | - | 1618813..1619040 (+) | 228 | WP_165619576.1 | hypothetical protein | - |
| KV238_RS07785 (KV238_07780) | - | 1619051..1619746 (+) | 696 | WP_165619581.1 | DNA-methyltransferase | - |
| KV238_RS07790 (KV238_07785) | - | 1619746..1620963 (+) | 1218 | WP_206151921.1 | DNA cytosine methyltransferase | - |
| KV238_RS07795 (KV238_07790) | - | 1620953..1621531 (+) | 579 | WP_206151920.1 | DUF1642 domain-containing protein | - |
| KV238_RS07800 (KV238_07795) | - | 1621528..1621695 (+) | 168 | WP_165619578.1 | hypothetical protein | - |
| KV238_RS07805 (KV238_07800) | - | 1621692..1621907 (+) | 216 | WP_165619579.1 | crAss001_48 related protein | - |
| KV238_RS07810 (KV238_07805) | - | 1621929..1622129 (+) | 201 | WP_165619580.1 | hypothetical protein | - |
| KV238_RS07815 (KV238_07810) | - | 1622153..1622572 (+) | 420 | WP_206151919.1 | DUF1492 domain-containing protein | - |
| KV238_RS07820 (KV238_07815) | - | 1622667..1623230 (+) | 564 | WP_206152563.1 | site-specific integrase | - |
| KV238_RS07825 (KV238_07820) | - | 1623401..1623697 (+) | 297 | WP_050316235.1 | hypothetical protein | - |
| KV238_RS07830 (KV238_07825) | - | 1623694..1624023 (+) | 330 | WP_165619586.1 | HNH endonuclease | - |
| KV238_RS07835 (KV238_07830) | - | 1624145..1624492 (+) | 348 | WP_002986187.1 | hypothetical protein | - |
| KV238_RS07840 (KV238_07835) | - | 1624473..1626131 (+) | 1659 | WP_165619585.1 | terminase TerL endonuclease subunit | - |
| KV238_RS07845 (KV238_07840) | - | 1626128..1626307 (+) | 180 | WP_165619584.1 | hypothetical protein | - |
| KV238_RS07850 (KV238_07845) | - | 1626325..1627560 (+) | 1236 | WP_050316230.1 | phage portal protein | - |
| KV238_RS07855 (KV238_07850) | - | 1627564..1628280 (+) | 717 | WP_050316229.1 | head maturation protease, ClpP-related | - |
| KV238_RS07860 (KV238_07855) | - | 1628318..1629511 (+) | 1194 | WP_230923495.1 | phage major capsid protein | - |
| KV238_RS07865 (KV238_07860) | - | 1629526..1629822 (+) | 297 | WP_050316227.1 | HeH/LEM domain-containing protein | - |
| KV238_RS07870 (KV238_07865) | - | 1629842..1630135 (+) | 294 | WP_050316226.1 | phage gp6-like head-tail connector protein | - |
| KV238_RS07875 (KV238_07870) | - | 1630137..1630514 (+) | 378 | WP_050316225.1 | hypothetical protein | - |
| KV238_RS07880 (KV238_07875) | - | 1630486..1630857 (+) | 372 | WP_050316224.1 | hypothetical protein | - |
| KV238_RS07885 (KV238_07880) | - | 1630866..1631288 (+) | 423 | WP_230923496.1 | hypothetical protein | - |
| KV238_RS07890 (KV238_07885) | - | 1631299..1631886 (+) | 588 | WP_230923497.1 | phage tail protein | - |
| KV238_RS07895 (KV238_07890) | - | 1631907..1632278 (+) | 372 | WP_050316219.1 | hypothetical protein | - |
| KV238_RS07900 (KV238_07895) | - | 1632314..1632472 (+) | 159 | WP_173476808.1 | hypothetical protein | - |
| KV238_RS07905 (KV238_07900) | - | 1632546..1635683 (+) | 3138 | WP_230923498.1 | phage tail tape measure protein | - |
| KV238_RS07910 (KV238_07905) | - | 1635680..1636390 (+) | 711 | WP_050316215.1 | phage tail domain-containing protein | - |
| KV238_RS07915 (KV238_07910) | - | 1636387..1638438 (+) | 2052 | WP_230923499.1 | phage tail spike protein | - |
| KV238_RS07920 (KV238_07915) | - | 1638435..1639319 (+) | 885 | WP_165619569.1 | collagen-like protein | - |
| KV238_RS07925 (KV238_07920) | - | 1639321..1639938 (+) | 618 | WP_230923500.1 | hypothetical protein | - |
| KV238_RS07930 (KV238_07925) | - | 1639949..1641853 (+) | 1905 | WP_165619567.1 | gp58-like family protein | - |
| KV238_RS07935 (KV238_07930) | - | 1641862..1642293 (+) | 432 | WP_165619566.1 | DUF1617 family protein | - |
| KV238_RS07940 (KV238_07935) | - | 1642297..1642908 (+) | 612 | WP_230923501.1 | DUF1366 domain-containing protein | - |
| KV238_RS07945 (KV238_07940) | - | 1642920..1643210 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| KV238_RS07950 (KV238_07945) | - | 1643213..1643392 (+) | 180 | WP_064056104.1 | hypothetical protein | - |
| KV238_RS07955 (KV238_07950) | - | 1643504..1644715 (+) | 1212 | WP_165619564.1 | glucosaminidase domain-containing protein | - |
| KV238_RS07960 (KV238_07955) | - | 1645096..1645671 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| KV238_RS07970 (KV238_07960) | prx | 1646021..1646209 (+) | 189 | WP_043983595.1 | Paratox | Regulator |
| KV238_RS07980 (KV238_07970) | - | 1646804..1647415 (+) | 612 | WP_041785453.1 | TVP38/TMEM64 family protein | - |
| KV238_RS07985 (KV238_07975) | - | 1647462..1648256 (-) | 795 | WP_012515506.1 | hypothetical protein | - |
| KV238_RS07990 (KV238_07980) | - | 1648266..1648964 (-) | 699 | WP_230923502.1 | ABC transporter ATP-binding protein | - |
| KV238_RS07995 (KV238_07985) | - | 1648964..1649335 (-) | 372 | WP_012515508.1 | GntR family transcriptional regulator | - |
| KV238_RS08000 (KV238_07990) | - | 1649578..1652688 (+) | 3111 | WP_230923503.1 | DNA polymerase III subunit alpha | - |
| KV238_RS08005 (KV238_07995) | pfkA | 1652768..1653781 (+) | 1014 | WP_012515510.1 | 6-phosphofructokinase | - |
| KV238_RS08010 (KV238_08000) | pyk | 1653843..1655345 (+) | 1503 | WP_012515511.1 | pyruvate kinase | - |
| KV238_RS08015 (KV238_08005) | lepB | 1655474..1656031 (+) | 558 | WP_012678044.1 | signal peptidase I | - |
| KV238_RS08020 (KV238_08010) | glmS | 1656208..1658019 (+) | 1812 | WP_230923504.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| KV238_RS08025 (KV238_08015) | - | 1658203..1658538 (+) | 336 | WP_012515514.1 | zinc ribbon domain-containing protein YjdM | - |
| KV238_RS08030 (KV238_08020) | - | 1658645..1659286 (+) | 642 | WP_042670568.1 | amino acid ABC transporter permease | - |
| KV238_RS08035 (KV238_08025) | - | 1659296..1659925 (+) | 630 | WP_165622803.1 | amino acid ABC transporter ATP-binding protein | - |
| KV238_RS08040 (KV238_08030) | - | 1659942..1660778 (+) | 837 | WP_043030751.1 | amino acid ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7221.23 Da Isoelectric Point: 5.0079
>NTDB_id=586272 KV238_RS07970 WP_043983595.1 1646021..1646209(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ_18-036]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHCIK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHCIK
Nucleotide
Download Length: 189 bp
>NTDB_id=586272 KV238_RS07970 WP_043983595.1 1646021..1646209(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ_18-036]
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTGTATTAAATGA
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTGTATTAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
93.548 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
67.742 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
67.742 |
0.548 |