Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU534_RS03190 | Genome accession | NZ_CP077923 |
| Coordinates | 615936..616406 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain 201 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 593620..644590 | 615936..616406 | within | 0 |
Gene organization within MGE regions
Location: 593620..644590
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU534_RS03035 (KU534_03005) | groES | 593620..593904 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| KU534_RS03040 (KU534_03010) | groL | 593980..595596 (+) | 1617 | WP_225805649.1 | chaperonin GroEL | - |
| KU534_RS03045 (KU534_03015) | - | 596137..596316 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| KU534_RS03050 (KU534_03020) | - | 596313..596939 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| KU534_RS03055 (KU534_03025) | - | 597478..598785 (-) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| KU534_RS03060 (KU534_03030) | - | 599168..600391 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| KU534_RS03065 (KU534_03035) | - | 600823..601878 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| KU534_RS03070 (KU534_03040) | - | 601900..602916 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| KU534_RS03075 (KU534_03045) | sph | 603178..604002 (-) | 825 | Protein_599 | sphingomyelin phosphodiesterase | - |
| KU534_RS03080 (KU534_03050) | - | 604059..605096 (-) | 1038 | WP_000857185.1 | tyrosine-type recombinase/integrase | - |
| KU534_RS03085 (KU534_03055) | - | 605155..605619 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| KU534_RS03090 (KU534_03060) | - | 605719..605901 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| KU534_RS03095 (KU534_03065) | - | 606105..606446 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| KU534_RS03100 (KU534_03070) | - | 606452..607384 (-) | 933 | WP_156975816.1 | exonuclease domain-containing protein | - |
| KU534_RS03105 (KU534_03075) | - | 607400..608113 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| KU534_RS03110 (KU534_03080) | - | 608076..608249 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| KU534_RS03115 (KU534_03085) | - | 608246..608509 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| KU534_RS03120 (KU534_03090) | - | 608525..608740 (+) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| KU534_RS03125 (KU534_03095) | - | 608729..609058 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| KU534_RS03130 (KU534_03100) | - | 609109..609861 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| KU534_RS03135 (KU534_03105) | - | 609877..610074 (+) | 198 | WP_001148855.1 | hypothetical protein | - |
| KU534_RS03140 (KU534_03110) | - | 610105..610245 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| KU534_RS03145 (KU534_03115) | - | 610260..610892 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| KU534_RS03150 (KU534_03120) | - | 610951..611271 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| KU534_RS03155 (KU534_03125) | - | 611268..611429 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| KU534_RS03160 (KU534_03130) | - | 611524..611850 (+) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| KU534_RS03165 (KU534_03135) | - | 611831..612091 (+) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| KU534_RS03170 (KU534_03140) | - | 612100..612363 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| KU534_RS03175 (KU534_03145) | - | 612372..614315 (+) | 1944 | WP_000700577.1 | AAA family ATPase | - |
| KU534_RS03180 (KU534_03150) | - | 614317..615237 (+) | 921 | WP_000138472.1 | recombinase RecT | - |
| KU534_RS03185 (KU534_03155) | - | 615318..615935 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| KU534_RS03190 (KU534_03160) | ssbA | 615936..616406 (+) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| KU534_RS03195 (KU534_03165) | - | 616436..617320 (+) | 885 | WP_000148316.1 | DnaD domain protein | - |
| KU534_RS03200 (KU534_03170) | - | 617327..617545 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| KU534_RS03205 (KU534_03175) | - | 617554..617958 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KU534_RS03210 (KU534_03180) | - | 617971..618339 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU534_RS03215 (KU534_03185) | - | 618343..618585 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| KU534_RS03220 (KU534_03190) | - | 618591..618764 (+) | 174 | WP_001793974.1 | hypothetical protein | - |
| KU534_RS03225 (KU534_03195) | - | 618757..619008 (+) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| KU534_RS03230 (KU534_03200) | - | 618998..619180 (+) | 183 | WP_000028422.1 | hypothetical protein | - |
| KU534_RS03235 (KU534_03205) | - | 619173..619715 (+) | 543 | WP_000185660.1 | dUTP diphosphatase | - |
| KU534_RS03240 (KU534_03210) | - | 619752..619958 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| KU534_RS03245 (KU534_03215) | - | 619955..620341 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| KU534_RS03250 (KU534_03220) | rinB | 620338..620487 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| KU534_RS03255 (KU534_03225) | - | 620487..620687 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| KU534_RS03260 (KU534_03230) | - | 620715..621131 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| KU534_RS03265 (KU534_03235) | - | 621363..621662 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| KU534_RS03270 (KU534_03240) | - | 621792..622136 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| KU534_RS03275 (KU534_03245) | - | 622133..623794 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| KU534_RS03280 (KU534_03250) | - | 623810..624997 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| KU534_RS03285 (KU534_03255) | - | 624981..625718 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| KU534_RS03290 (KU534_03260) | - | 625742..626887 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| KU534_RS03295 (KU534_03265) | - | 626907..627191 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| KU534_RS03300 (KU534_03270) | - | 627181..627465 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| KU534_RS03305 (KU534_03275) | - | 627449..627811 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| KU534_RS03310 (KU534_03280) | - | 627808..628212 (+) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| KU534_RS03315 (KU534_03285) | - | 628209..628616 (+) | 408 | WP_000565496.1 | hypothetical protein | - |
| KU534_RS03320 (KU534_03290) | - | 628617..629261 (+) | 645 | WP_000268741.1 | major tail protein | - |
| KU534_RS03325 (KU534_03295) | - | 629315..629527 (+) | 213 | WP_230402383.1 | Ig-like domain-containing protein | - |
| KU534_RS03330 (KU534_03300) | gpG | 629577..629927 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| KU534_RS03335 (KU534_03305) | gpGT | 629978..630115 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| KU534_RS03340 (KU534_03310) | - | 630172..634701 (+) | 4530 | WP_001807909.1 | phage tail tape measure protein | - |
| KU534_RS03345 (KU534_03315) | - | 634698..636182 (+) | 1485 | WP_000567415.1 | phage distal tail protein | - |
| KU534_RS03350 (KU534_03320) | - | 636198..639878 (+) | 3681 | WP_000582140.1 | phage tail spike protein | - |
| KU534_RS03355 (KU534_03325) | - | 639865..640017 (+) | 153 | WP_001181555.1 | hypothetical protein | - |
| KU534_RS03360 (KU534_03330) | - | 640064..640351 (+) | 288 | WP_001040257.1 | hypothetical protein | - |
| KU534_RS03365 (KU534_03335) | - | 640409..640705 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| KU534_RS03370 (KU534_03340) | - | 640937..641044 (+) | 108 | WP_000253688.1 | putative holin-like toxin | - |
| KU534_RS03375 (KU534_03345) | - | 641088..641192 (-) | 105 | Protein_659 | hypothetical protein | - |
| KU534_RS03380 (KU534_03350) | - | 641243..641545 (+) | 303 | WP_000387656.1 | phage holin | - |
| KU534_RS03385 (KU534_03355) | - | 641557..643011 (+) | 1455 | WP_000930259.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KU534_RS03390 (KU534_03360) | - | 643106..643555 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KU534_RS03395 (KU534_03365) | scn | 644240..644590 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=585234 KU534_RS03190 WP_000934764.1 615936..616406(+) (ssbA) [Staphylococcus aureus strain 201]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=585234 KU534_RS03190 WP_000934764.1 615936..616406(+) (ssbA) [Staphylococcus aureus strain 201]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |