Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU538_RS06970 | Genome accession | NZ_CP077922 |
| Coordinates | 1402836..1403306 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain 202 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1374652..1425622 | 1402836..1403306 | within | 0 |
Gene organization within MGE regions
Location: 1374652..1425622
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU538_RS06765 (KU538_06725) | scn | 1374652..1375002 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| KU538_RS06770 (KU538_06730) | - | 1375687..1376136 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KU538_RS06775 (KU538_06735) | - | 1376231..1377685 (-) | 1455 | WP_000930259.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KU538_RS06780 (KU538_06740) | - | 1377697..1377999 (-) | 303 | WP_000387656.1 | phage holin | - |
| KU538_RS06785 (KU538_06745) | - | 1378050..1378154 (+) | 105 | Protein_1315 | hypothetical protein | - |
| KU538_RS06790 (KU538_06750) | - | 1378198..1378305 (-) | 108 | WP_000253688.1 | putative holin-like toxin | - |
| KU538_RS06795 (KU538_06755) | - | 1378537..1378833 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| KU538_RS06800 (KU538_06760) | - | 1378891..1379178 (-) | 288 | WP_001040257.1 | hypothetical protein | - |
| KU538_RS06805 (KU538_06765) | - | 1379225..1379377 (-) | 153 | WP_001181555.1 | hypothetical protein | - |
| KU538_RS06810 (KU538_06770) | - | 1379364..1383044 (-) | 3681 | WP_000582140.1 | phage tail spike protein | - |
| KU538_RS06815 (KU538_06775) | - | 1383060..1384544 (-) | 1485 | WP_000567415.1 | phage distal tail protein | - |
| KU538_RS06820 (KU538_06780) | - | 1384541..1389070 (-) | 4530 | WP_001807909.1 | phage tail tape measure protein | - |
| KU538_RS06825 (KU538_06785) | gpGT | 1389127..1389264 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| KU538_RS06830 (KU538_06790) | gpG | 1389315..1389665 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| KU538_RS06835 (KU538_06795) | - | 1389715..1389939 (-) | 225 | WP_072050172.1 | Ig-like domain-containing protein | - |
| KU538_RS06840 (KU538_06800) | - | 1389981..1390625 (-) | 645 | WP_000268741.1 | major tail protein | - |
| KU538_RS06845 (KU538_06805) | - | 1390626..1391033 (-) | 408 | WP_000565496.1 | hypothetical protein | - |
| KU538_RS06850 (KU538_06810) | - | 1391030..1391434 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| KU538_RS06855 (KU538_06815) | - | 1391431..1391793 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| KU538_RS06860 (KU538_06820) | - | 1391777..1392061 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| KU538_RS06865 (KU538_06825) | - | 1392051..1392335 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| KU538_RS06870 (KU538_06830) | - | 1392355..1393500 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| KU538_RS06875 (KU538_06835) | - | 1393524..1394261 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| KU538_RS06880 (KU538_06840) | - | 1394245..1395432 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| KU538_RS06885 (KU538_06845) | - | 1395448..1397109 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| KU538_RS06890 (KU538_06850) | - | 1397106..1397450 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| KU538_RS06895 (KU538_06855) | - | 1397580..1397879 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| KU538_RS06900 (KU538_06860) | - | 1398111..1398527 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| KU538_RS06905 (KU538_06865) | - | 1398555..1398755 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| KU538_RS06910 (KU538_06870) | rinB | 1398755..1398904 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| KU538_RS06915 (KU538_06875) | - | 1398901..1399287 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| KU538_RS06920 (KU538_06880) | - | 1399284..1399490 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| KU538_RS06925 (KU538_06885) | - | 1399527..1400069 (-) | 543 | WP_000185660.1 | dUTP diphosphatase | - |
| KU538_RS06930 (KU538_06890) | - | 1400062..1400244 (-) | 183 | WP_000028422.1 | hypothetical protein | - |
| KU538_RS06935 (KU538_06895) | - | 1400234..1400485 (-) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| KU538_RS06940 (KU538_06900) | - | 1400478..1400645 (-) | 168 | WP_001624242.1 | hypothetical protein | - |
| KU538_RS06945 (KU538_06905) | - | 1400657..1400899 (-) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| KU538_RS06950 (KU538_06910) | - | 1400903..1401271 (-) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU538_RS06955 (KU538_06915) | - | 1401284..1401688 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KU538_RS06960 (KU538_06920) | - | 1401697..1401915 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| KU538_RS06965 (KU538_06925) | - | 1401922..1402806 (-) | 885 | WP_000148316.1 | DnaD domain protein | - |
| KU538_RS06970 (KU538_06930) | ssbA | 1402836..1403306 (-) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| KU538_RS06975 (KU538_06935) | - | 1403307..1403924 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| KU538_RS06980 (KU538_06940) | - | 1404005..1404925 (-) | 921 | WP_000138472.1 | recombinase RecT | - |
| KU538_RS06985 (KU538_06945) | - | 1404927..1406870 (-) | 1944 | WP_000700577.1 | AAA family ATPase | - |
| KU538_RS06990 (KU538_06950) | - | 1406879..1407142 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| KU538_RS06995 (KU538_06955) | - | 1407151..1407411 (-) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| KU538_RS07000 (KU538_06960) | - | 1407392..1407718 (-) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| KU538_RS07005 (KU538_06965) | - | 1407813..1407974 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| KU538_RS07010 (KU538_06970) | - | 1407971..1408291 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| KU538_RS07015 (KU538_06975) | - | 1408350..1408982 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| KU538_RS07020 (KU538_06980) | - | 1408997..1409137 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| KU538_RS07025 (KU538_06985) | - | 1409168..1409365 (-) | 198 | WP_001148855.1 | hypothetical protein | - |
| KU538_RS07030 (KU538_06990) | - | 1409381..1410133 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| KU538_RS07035 (KU538_06995) | - | 1410184..1410513 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| KU538_RS07040 (KU538_07000) | - | 1410502..1410717 (-) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| KU538_RS07045 (KU538_07005) | - | 1410733..1410996 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| KU538_RS07050 (KU538_07010) | - | 1410993..1411166 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| KU538_RS07055 (KU538_07015) | - | 1411129..1411842 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| KU538_RS07060 (KU538_07020) | - | 1411858..1412790 (+) | 933 | WP_156975816.1 | exonuclease domain-containing protein | - |
| KU538_RS07065 (KU538_07025) | - | 1412796..1413137 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| KU538_RS07070 (KU538_07030) | - | 1413341..1413523 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| KU538_RS07075 (KU538_07035) | - | 1413623..1414087 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| KU538_RS07080 (KU538_07040) | - | 1414146..1415183 (+) | 1038 | WP_000857185.1 | tyrosine-type recombinase/integrase | - |
| KU538_RS07085 (KU538_07045) | sph | 1415240..1416064 (+) | 825 | Protein_1375 | sphingomyelin phosphodiesterase | - |
| KU538_RS07090 (KU538_07050) | - | 1416326..1417342 (-) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| KU538_RS07095 (KU538_07055) | - | 1417364..1418419 (-) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| KU538_RS07100 (KU538_07060) | - | 1418851..1420074 (+) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| KU538_RS07105 (KU538_07065) | - | 1420457..1421764 (+) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| KU538_RS07110 (KU538_07070) | - | 1422303..1422929 (-) | 627 | WP_000216896.1 | hypothetical protein | - |
| KU538_RS07115 (KU538_07075) | - | 1422926..1423105 (-) | 180 | WP_000201398.1 | hypothetical protein | - |
| KU538_RS07120 (KU538_07080) | groL | 1423646..1425262 (-) | 1617 | WP_225805649.1 | chaperonin GroEL | - |
| KU538_RS07125 (KU538_07085) | groES | 1425338..1425622 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=585217 KU538_RS06970 WP_000934764.1 1402836..1403306(-) (ssbA) [Staphylococcus aureus strain 202]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=585217 KU538_RS06970 WP_000934764.1 1402836..1403306(-) (ssbA) [Staphylococcus aureus strain 202]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |