Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU533_RS13075 | Genome accession | NZ_CP077857 |
| Coordinates | 2652561..2653031 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain L4 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2635813..2688389 | 2652561..2653031 | within | 0 |
Gene organization within MGE regions
Location: 2635813..2688389
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU533_RS12945 (KU533_12885) | - | 2635813..2637036 (-) | 1224 | WP_031763515.1 | ArgE/DapE family deacylase | - |
| KU533_RS12950 (KU533_12890) | lukH | 2637472..2638527 (+) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| KU533_RS12955 (KU533_12895) | lukG | 2638549..2639565 (+) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| KU533_RS12960 (KU533_12900) | sph | 2639803..2640627 (-) | 825 | Protein_2506 | sphingomyelin phosphodiesterase | - |
| KU533_RS12965 (KU533_12905) | - | 2640684..2641721 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| KU533_RS12970 (KU533_12910) | - | 2641780..2642244 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| KU533_RS12975 (KU533_12915) | - | 2642344..2642526 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| KU533_RS12980 (KU533_12920) | - | 2642730..2643071 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| KU533_RS12985 (KU533_12925) | - | 2643077..2644009 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| KU533_RS12990 (KU533_12930) | - | 2644025..2644738 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| KU533_RS12995 (KU533_12935) | - | 2644701..2644874 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| KU533_RS13000 (KU533_12940) | - | 2644871..2645134 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| KU533_RS13005 (KU533_12945) | - | 2645150..2645365 (+) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| KU533_RS13010 (KU533_12950) | - | 2645354..2645683 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| KU533_RS13015 (KU533_12955) | - | 2645734..2646486 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| KU533_RS13020 (KU533_12960) | - | 2646502..2646699 (+) | 198 | WP_001148855.1 | hypothetical protein | - |
| KU533_RS13025 (KU533_12965) | - | 2646730..2646870 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| KU533_RS13030 (KU533_12970) | - | 2646885..2647517 (-) | 633 | WP_225798617.1 | hypothetical protein | - |
| KU533_RS13035 (KU533_12975) | - | 2647576..2647896 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| KU533_RS13040 (KU533_12980) | - | 2647893..2648054 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| KU533_RS13045 (KU533_12985) | - | 2648149..2648475 (+) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| KU533_RS13050 (KU533_12990) | - | 2648456..2648716 (+) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| KU533_RS13055 (KU533_12995) | - | 2648725..2648988 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| KU533_RS13060 (KU533_13000) | - | 2648997..2650940 (+) | 1944 | WP_000700577.1 | AAA family ATPase | - |
| KU533_RS13065 (KU533_13005) | - | 2650942..2651862 (+) | 921 | WP_000138472.1 | recombinase RecT | - |
| KU533_RS13070 (KU533_13010) | - | 2651943..2652560 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| KU533_RS13075 (KU533_13015) | ssbA | 2652561..2653031 (+) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| KU533_RS13080 (KU533_13020) | - | 2653061..2653945 (+) | 885 | WP_000148316.1 | DnaD domain protein | - |
| KU533_RS13085 (KU533_13025) | - | 2653952..2654170 (+) | 219 | WP_000338531.1 | hypothetical protein | - |
| KU533_RS13090 (KU533_13030) | - | 2654179..2654488 (+) | 310 | Protein_2532 | RusA family crossover junction endodeoxyribonuclease | - |
| KU533_RS13095 (KU533_13035) | - | 2654501..2654869 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU533_RS13100 (KU533_13040) | - | 2654873..2655115 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| KU533_RS13105 (KU533_13045) | - | 2655127..2655294 (+) | 168 | WP_001624242.1 | hypothetical protein | - |
| KU533_RS13110 (KU533_13050) | - | 2655287..2655538 (+) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| KU533_RS13115 (KU533_13055) | - | 2655528..2655710 (+) | 183 | WP_000028422.1 | hypothetical protein | - |
| KU533_RS13120 (KU533_13060) | - | 2655703..2656245 (+) | 543 | WP_000185659.1 | dUTP diphosphatase | - |
| KU533_RS13125 (KU533_13065) | - | 2656282..2656488 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| KU533_RS13130 (KU533_13070) | - | 2656485..2656871 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| KU533_RS13135 (KU533_13075) | rinB | 2656868..2657017 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| KU533_RS13140 (KU533_13080) | - | 2657017..2657217 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| KU533_RS13145 (KU533_13085) | - | 2657245..2657661 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| KU533_RS13150 (KU533_13090) | - | 2657893..2658192 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| KU533_RS13155 (KU533_13095) | - | 2658322..2658666 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| KU533_RS13160 (KU533_13100) | - | 2658663..2660324 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| KU533_RS13165 (KU533_13105) | - | 2660340..2661527 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| KU533_RS13170 (KU533_13110) | - | 2661511..2662248 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| KU533_RS13175 (KU533_13115) | - | 2662272..2663417 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| KU533_RS13180 (KU533_13120) | - | 2663437..2663721 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| KU533_RS13185 (KU533_13125) | - | 2663711..2663995 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| KU533_RS13190 (KU533_13130) | - | 2663979..2664341 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| KU533_RS13195 (KU533_13135) | - | 2664338..2664742 (+) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| KU533_RS13200 (KU533_13140) | - | 2664739..2665146 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| KU533_RS13205 (KU533_13145) | - | 2665147..2665791 (+) | 645 | WP_000268735.1 | major tail protein | - |
| KU533_RS13210 (KU533_13150) | - | 2665827..2666057 (+) | 231 | Protein_2556 | Ig-like domain-containing protein | - |
| KU533_RS13215 (KU533_13155) | gpG | 2666107..2666457 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| KU533_RS13765 | gpGT | 2666508..2666645 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| KU533_RS13220 (KU533_13160) | - | 2666702..2671231 (+) | 4530 | WP_225798618.1 | phage tail tape measure protein | - |
| KU533_RS13225 (KU533_13165) | - | 2671228..2672712 (+) | 1485 | WP_000567413.1 | phage distal tail protein | - |
| KU533_RS13230 (KU533_13170) | - | 2672728..2676513 (+) | 3786 | WP_000582190.1 | phage tail spike protein | - |
| KU533_RS13235 (KU533_13175) | - | 2676503..2676655 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| KU533_RS13240 (KU533_13180) | - | 2676702..2676989 (+) | 288 | WP_001040259.1 | hypothetical protein | - |
| KU533_RS13245 (KU533_13185) | - | 2677045..2677419 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| KU533_RS13250 (KU533_13190) | sea | 2677840..2678613 (+) | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| KU533_RS13255 (KU533_13195) | pepG1 | 2678764..2678898 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| KU533_RS13260 (KU533_13200) | - | 2678951..2679058 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| KU533_RS13265 (KU533_13205) | - | 2679110..2679364 (+) | 255 | WP_000611512.1 | phage holin | - |
| KU533_RS13270 (KU533_13210) | - | 2679376..2680131 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KU533_RS13275 (KU533_13215) | sak | 2680322..2680813 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| KU533_RS13280 (KU533_13220) | - | 2681460..2681798 (+) | 339 | Protein_2571 | SH3 domain-containing protein | - |
| KU533_RS13285 (KU533_13225) | - | 2681893..2682342 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KU533_RS13290 (KU533_13230) | scn | 2683028..2683378 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| KU533_RS13295 (KU533_13235) | - | 2683431..2683691 (-) | 261 | WP_001791826.1 | hypothetical protein | - |
| KU533_RS13800 | - | 2683670..2683978 (-) | 309 | WP_001789576.1 | hypothetical protein | - |
| KU533_RS13300 (KU533_13240) | - | 2684002..2684181 (-) | 180 | WP_000669789.1 | hypothetical protein | - |
| KU533_RS13305 (KU533_13245) | - | 2684553..2684750 (-) | 198 | WP_000239610.1 | phospholipase | - |
| KU533_RS13310 (KU533_13250) | eap | 2685139..2686569 (+) | 1431 | WP_001557458.1 | extracellular adherence protein Eap/Map | - |
| KU533_RS13315 (KU533_13255) | - | 2686584..2686874 (+) | 291 | WP_000671712.1 | MAP domain-containing protein | - |
| KU533_RS13320 (KU533_13260) | - | 2687070..2688389 (+) | 1320 | WP_001557163.1 | ISL3-like element IS1181 family transposase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=583959 KU533_RS13075 WP_000934764.1 2652561..2653031(+) (ssbA) [Staphylococcus aureus strain L4]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=583959 KU533_RS13075 WP_000934764.1 2652561..2653031(+) (ssbA) [Staphylococcus aureus strain L4]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |