Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | VB13_RS05885 | Genome accession | NZ_CP077685 |
| Coordinates | 1203107..1203289 (-) | Length | 60 a.a. |
| NCBI ID | WP_009880238.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain M49 591 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1203107..1237775 | 1203107..1203289 | within | 0 |
Gene organization within MGE regions
Location: 1203107..1237775
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VB13_RS05885 (VB13_06060) | prx | 1203107..1203289 (-) | 183 | WP_009880238.1 | hypothetical protein | Regulator |
| VB13_RS05890 (VB13_06065) | speA | 1203510..1204265 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| VB13_RS05895 (VB13_06070) | - | 1204387..1205046 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| VB13_RS05900 (VB13_06075) | - | 1205046..1205267 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| VB13_RS05905 (VB13_06080) | - | 1205277..1206050 (-) | 774 | WP_009880242.1 | hypothetical protein | - |
| VB13_RS05910 (VB13_06085) | - | 1206061..1206663 (-) | 603 | WP_009880243.1 | hypothetical protein | - |
| VB13_RS05915 (VB13_06090) | - | 1206675..1207430 (-) | 756 | WP_219050256.1 | CHAP domain-containing protein | - |
| VB13_RS05920 (VB13_06095) | - | 1207432..1207764 (-) | 333 | WP_009880245.1 | phage holin | - |
| VB13_RS05925 (VB13_06100) | - | 1207764..1208087 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| VB13_RS08715 (VB13_06105) | - | 1208101..1208223 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| VB13_RS05930 (VB13_06110) | - | 1208237..1208584 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| VB13_RS05935 (VB13_06115) | - | 1208595..1210457 (-) | 1863 | WP_009880248.1 | DUF859 family phage minor structural protein | - |
| VB13_RS05940 (VB13_06120) | - | 1210462..1213902 (-) | 3441 | WP_009880249.1 | glucosaminidase domain-containing protein | - |
| VB13_RS05945 (VB13_06125) | - | 1213903..1215387 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| VB13_RS05950 (VB13_06130) | - | 1215388..1217193 (-) | 1806 | WP_219050258.1 | phage tail protein | - |
| VB13_RS05955 (VB13_06135) | - | 1217186..1217644 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| VB13_RS05960 (VB13_06140) | - | 1217617..1217934 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| VB13_RS05965 (VB13_06145) | - | 1217947..1218453 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| VB13_RS05970 (VB13_06150) | - | 1218465..1218875 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| VB13_RS05975 (VB13_06155) | - | 1218877..1219272 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| VB13_RS05980 (VB13_06160) | - | 1219269..1219580 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| VB13_RS05985 (VB13_06165) | - | 1219577..1219921 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| VB13_RS05990 (VB13_06170) | - | 1219935..1220228 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| VB13_RS05995 (VB13_06175) | - | 1220240..1221130 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| VB13_RS06000 (VB13_06180) | - | 1221148..1221717 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| VB13_RS06005 (VB13_06185) | - | 1221867..1222133 (-) | 267 | WP_009880263.1 | hypothetical protein | - |
| VB13_RS06010 (VB13_06190) | - | 1222140..1223048 (-) | 909 | WP_009880264.1 | minor capsid protein | - |
| VB13_RS06015 (VB13_06195) | - | 1223017..1224342 (-) | 1326 | WP_009880265.1 | phage portal protein | - |
| VB13_RS06020 (VB13_06200) | - | 1224342..1225616 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| VB13_RS06025 (VB13_06205) | - | 1225606..1225986 (-) | 381 | WP_043884959.1 | hypothetical protein | - |
| VB13_RS06030 (VB13_06210) | - | 1226330..1226764 (-) | 435 | WP_009880268.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| VB13_RS06035 (VB13_06220) | - | 1227142..1227426 (-) | 285 | WP_009880269.1 | hypothetical protein | - |
| VB13_RS06040 (VB13_06225) | - | 1227423..1227836 (-) | 414 | WP_032460569.1 | YopX family protein | - |
| VB13_RS06045 (VB13_06230) | - | 1227846..1228115 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| VB13_RS06050 (VB13_06235) | - | 1228112..1228397 (-) | 286 | Protein_1156 | DUF3310 domain-containing protein | - |
| VB13_RS08720 (VB13_06240) | - | 1228391..1228588 (-) | 198 | WP_043884960.1 | hypothetical protein | - |
| VB13_RS06055 (VB13_06245) | - | 1228575..1228973 (-) | 399 | WP_009880272.1 | hypothetical protein | - |
| VB13_RS06060 (VB13_06250) | - | 1229146..1229313 (-) | 168 | WP_009880273.1 | hypothetical protein | - |
| VB13_RS06065 (VB13_06255) | - | 1229323..1230120 (-) | 798 | WP_009880274.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| VB13_RS06070 (VB13_06260) | - | 1230117..1231045 (-) | 929 | Protein_1161 | recombinase RecT | - |
| VB13_RS06075 (VB13_06265) | - | 1231048..1231377 (-) | 330 | WP_009880276.1 | hypothetical protein | - |
| VB13_RS06080 (VB13_06270) | - | 1231399..1231653 (-) | 255 | WP_063629029.1 | hypothetical protein | - |
| VB13_RS06085 (VB13_06275) | - | 1231640..1231987 (-) | 348 | WP_219050260.1 | hypothetical protein | - |
| VB13_RS06090 (VB13_06285) | - | 1232128..1232910 (-) | 783 | WP_111688424.1 | ATP-binding protein | - |
| VB13_RS06095 (VB13_06290) | - | 1232897..1233727 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| VB13_RS06100 (VB13_06295) | - | 1233741..1234055 (-) | 315 | WP_043885080.1 | helix-turn-helix domain-containing protein | - |
| VB13_RS06105 (VB13_06300) | - | 1234288..1234506 (-) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| VB13_RS06110 (VB13_06305) | - | 1234695..1235054 (+) | 360 | WP_011528540.1 | helix-turn-helix transcriptional regulator | - |
| VB13_RS06115 (VB13_06310) | - | 1235038..1235415 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| VB13_RS06120 (VB13_06315) | - | 1235426..1235578 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| VB13_RS06125 (VB13_06320) | - | 1235749..1236435 (+) | 687 | WP_043885029.1 | hypothetical protein | - |
| VB13_RS06130 (VB13_06325) | - | 1236609..1237775 (+) | 1167 | WP_009880742.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7000.05 Da Isoelectric Point: 4.3184
>NTDB_id=582246 VB13_RS05885 WP_009880238.1 1203107..1203289(-) (prx) [Streptococcus pyogenes strain M49 591]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEDVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEDVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=582246 VB13_RS05885 WP_009880238.1 1203107..1203289(-) (prx) [Streptococcus pyogenes strain M49 591]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGACG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGACG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
100 |
0.667 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |