Detailed information
Bioinformatically predicted
Overview
| Name | comC | Type | Regulator |
| Locus tag | I6L86_RS03415 | Genome accession | NZ_CP077259 |
| Coordinates | 748455..748577 (-) | Length | 40 a.a. |
| NCBI ID | WP_004238992.1 | Uniprot ID | O33675 |
| Organism | Streptococcus mitis strain FDAARGOS 1456 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 743455..753577
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6L86_RS03390 (I6L86_03390) | - | 745583..746125 (+) | 543 | WP_001158274.1 | TetR/AcrR family transcriptional regulator | - |
| I6L86_RS03405 (I6L86_03405) | comE | 746368..747120 (-) | 753 | WP_000866073.1 | competence system response regulator transcription factor ComE | Regulator |
| I6L86_RS03410 (I6L86_03410) | comD | 747117..748442 (-) | 1326 | WP_020902616.1 | competence system sensor histidine kinase ComD | Regulator |
| I6L86_RS03415 (I6L86_03415) | comC | 748455..748577 (-) | 123 | WP_004238992.1 | competence-stimulating peptide ComC | Regulator |
| I6L86_RS03425 (I6L86_03425) | rlmH | 748860..749339 (-) | 480 | WP_000695934.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| I6L86_RS03430 (I6L86_03430) | htrA | 749522..750703 (+) | 1182 | WP_000681587.1 | S1C family serine protease | Regulator |
| I6L86_RS03435 (I6L86_03435) | spo0J | 750761..751519 (+) | 759 | WP_000410370.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| I6L86_RS03440 (I6L86_03440) | dnaA | 751732..753093 (+) | 1362 | WP_000660620.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4897.64 Da Isoelectric Point: 10.6104
>NTDB_id=580360 I6L86_RS03415 WP_004238992.1 748455..748577(-) (comC) [Streptococcus mitis strain FDAARGOS 1456]
MKNTVNLDKFVELKEKDLQNIQGGEIRQTHNIFFNFFKRR
MKNTVNLDKFVELKEKDLQNIQGGEIRQTHNIFFNFFKRR
Nucleotide
Download Length: 123 bp
>NTDB_id=580360 I6L86_RS03415 WP_004238992.1 748455..748577(-) (comC) [Streptococcus mitis strain FDAARGOS 1456]
ATGAAAAACACAGTTAATTTAGATAAGTTTGTAGAATTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATAAG
GCAAACACATAATATTTTCTTTAATTTCTTTAAAAGAAGATAA
ATGAAAAACACAGTTAATTTAGATAAGTTTGTAGAATTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATAAG
GCAAACACATAATATTTTCTTTAATTTCTTTAAAAGAAGATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis NCTC 12261 |
100 |
100 |
1 |
| comC | Streptococcus mitis SK321 |
66.667 |
90 |
0.6 |
| comC/comC2 | Streptococcus pneumoniae A66 |
57.5 |
100 |
0.575 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
57.5 |
100 |
0.575 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
74.074 |
67.5 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae R6 |
74.074 |
67.5 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae G54 |
74.074 |
67.5 |
0.5 |
| comC/comC1 | Streptococcus pneumoniae D39 |
74.074 |
67.5 |
0.5 |