Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | KM399_RS25765 | Genome accession | NZ_CP076192 |
| Coordinates | 4873551..4874132 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049158.1 | Uniprot ID | - |
| Organism | Bacillus anthracis strain UR-1 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4827220..4874132 | 4873551..4874132 | within | 0 |
Gene organization within MGE regions
Location: 4827220..4874132
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KM399_RS25485 (KM399_25465) | speG | 4827220..4827735 (-) | 516 | WP_000076824.1 | spermidine N1-acetyltransferase | - |
| KM399_RS25490 (KM399_25470) | psiE | 4827879..4828283 (-) | 405 | WP_000834704.1 | phosphate-starvation-inducible protein PsiE | - |
| KM399_RS25495 (KM399_25475) | - | 4828333..4829295 (-) | 963 | WP_000635749.1 | nuclease-related domain-containing protein | - |
| KM399_RS25500 (KM399_25480) | - | 4829731..4830696 (+) | 966 | WP_001036602.1 | DUF4822 domain-containing protein | - |
| KM399_RS25505 (KM399_25485) | - | 4830921..4831673 (-) | 753 | WP_000590068.1 | siderophore ABC transporter ATP-binding protein | - |
| KM399_RS25510 (KM399_25490) | - | 4831670..4832734 (-) | 1065 | WP_000631132.1 | iron chelate uptake ABC transporter family permease subunit | - |
| KM399_RS25515 (KM399_25495) | - | 4832731..4833747 (-) | 1017 | WP_000042061.1 | iron chelate uptake ABC transporter family permease subunit | - |
| KM399_RS25520 (KM399_25500) | - | 4833767..4834780 (-) | 1014 | WP_000753441.1 | siderophore ABC transporter substrate-binding protein | - |
| KM399_RS25525 (KM399_25505) | - | 4835195..4835872 (-) | 678 | WP_001250248.1 | response regulator transcription factor | - |
| KM399_RS25535 (KM399_25515) | smpB | 4836761..4837228 (-) | 468 | WP_001123905.1 | SsrA-binding protein | - |
| KM399_RS25540 (KM399_25520) | rnr | 4837477..4839903 (-) | 2427 | WP_000391091.1 | ribonuclease R | - |
| KM399_RS25545 (KM399_25525) | estA | 4840046..4840786 (-) | 741 | WP_000761977.1 | carboxylesterase | - |
| KM399_RS25550 (KM399_25530) | secG | 4840948..4841181 (-) | 234 | WP_000557262.1 | preprotein translocase subunit SecG | - |
| KM399_RS25555 (KM399_25535) | - | 4841276..4841968 (-) | 693 | WP_000078306.1 | LrgB family protein | - |
| KM399_RS25560 (KM399_25540) | - | 4841965..4842333 (-) | 369 | WP_000673222.1 | CidA/LrgA family holin-like protein | - |
| KM399_RS25565 (KM399_25545) | - | 4842609..4843559 (+) | 951 | WP_001125043.1 | nucleoside hydrolase | - |
| KM399_RS28900 (KM399_25550) | - | 4843610..4843723 (-) | 114 | WP_085938713.1 | hypothetical protein | - |
| KM399_RS25570 (KM399_25555) | - | 4844047..4844559 (-) | 513 | WP_000422852.1 | hypothetical protein | - |
| KM399_RS25575 (KM399_25560) | - | 4844717..4845175 (-) | 459 | WP_000711928.1 | hypothetical protein | - |
| KM399_RS25580 (KM399_25565) | - | 4845592..4846401 (-) | 810 | WP_000639551.1 | NUMOD4 domain-containing protein | - |
| KM399_RS25585 (KM399_25570) | - | 4846576..4847205 (-) | 630 | WP_000142503.1 | hypothetical protein | - |
| KM399_RS25590 (KM399_25575) | - | 4847393..4847743 (-) | 351 | WP_000817546.1 | DUF2513 domain-containing protein | - |
| KM399_RS25595 (KM399_25580) | - | 4847888..4848364 (+) | 477 | WP_001003949.1 | hypothetical protein | - |
| KM399_RS28905 | - | 4848430..4848558 (-) | 129 | WP_003162515.1 | hypothetical protein | - |
| KM399_RS25600 (KM399_25585) | - | 4848603..4848815 (-) | 213 | WP_000660592.1 | hypothetical protein | - |
| KM399_RS25605 (KM399_25590) | - | 4848821..4849066 (-) | 246 | WP_001008127.1 | helix-turn-helix domain-containing protein | - |
| KM399_RS25610 (KM399_25595) | - | 4849063..4849308 (-) | 246 | WP_000823894.1 | hypothetical protein | - |
| KM399_RS25615 (KM399_25600) | - | 4849461..4849664 (+) | 204 | WP_000502531.1 | hypothetical protein | - |
| KM399_RS29025 (KM399_25605) | - | 4849683..4850421 (+) | 739 | Protein_5011 | transcriptional regulator | - |
| KM399_RS25630 (KM399_25610) | - | 4850832..4851023 (+) | 192 | WP_001001289.1 | hypothetical protein | - |
| KM399_RS25635 (KM399_25615) | - | 4851120..4851707 (+) | 588 | WP_000900865.1 | hypothetical protein | - |
| KM399_RS25640 (KM399_25620) | - | 4851700..4853271 (+) | 1572 | WP_003159006.1 | terminase TerL endonuclease subunit | - |
| KM399_RS25645 | - | 4853271..4853456 (+) | 186 | WP_000443127.1 | hypothetical protein | - |
| KM399_RS28910 (KM399_25625) | - | 4853422..4853814 (+) | 393 | WP_226992602.1 | HNH endonuclease signature motif containing protein | - |
| KM399_RS25655 (KM399_25630) | - | 4854231..4855541 (+) | 1311 | WP_000522484.1 | phage portal protein | - |
| KM399_RS25660 (KM399_25635) | - | 4855513..4856010 (+) | 498 | WP_003159003.1 | HK97 family phage prohead protease | - |
| KM399_RS25665 (KM399_25640) | - | 4856070..4857110 (+) | 1041 | WP_003159030.1 | phage major capsid protein | - |
| KM399_RS25670 (KM399_25645) | - | 4857197..4858177 (+) | 981 | WP_000168836.1 | phage major capsid protein | - |
| KM399_RS25675 (KM399_25650) | - | 4858245..4859111 (-) | 867 | WP_000348695.1 | hypothetical protein | - |
| KM399_RS25680 (KM399_25655) | - | 4859234..4860139 (-) | 906 | WP_000910235.1 | tyrosine-type recombinase/integrase | - |
| KM399_RS25685 (KM399_25660) | eno | 4860283..4861578 (-) | 1296 | WP_000103949.1 | phosphopyruvate hydratase | - |
| KM399_RS25690 (KM399_25665) | gpmI | 4861609..4863138 (-) | 1530 | WP_001231153.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| KM399_RS25695 (KM399_25670) | tpiA | 4863135..4863890 (-) | 756 | WP_001231039.1 | triose-phosphate isomerase | - |
| KM399_RS25700 (KM399_25675) | - | 4863923..4865107 (-) | 1185 | WP_001036337.1 | phosphoglycerate kinase | - |
| KM399_RS25705 (KM399_25680) | gap | 4865247..4866251 (-) | 1005 | WP_000161236.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| KM399_RS25710 (KM399_25685) | cggR | 4866278..4867306 (-) | 1029 | WP_001258187.1 | gapA transcriptional regulator CggR | - |
| KM399_RS25715 (KM399_25690) | - | 4867443..4867688 (-) | 246 | WP_000869728.1 | glutaredoxin family protein | - |
| KM399_RS25720 (KM399_25695) | rpoN | 4867698..4869005 (-) | 1308 | WP_000647981.1 | RNA polymerase factor sigma-54 | - |
| KM399_RS25730 (KM399_25705) | - | 4869545..4869751 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| KM399_RS25735 (KM399_25710) | - | 4869845..4870330 (+) | 486 | WP_001228539.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| KM399_RS25740 (KM399_25715) | spoVAC | 4870361..4870837 (+) | 477 | WP_000095399.1 | stage V sporulation protein AC | - |
| KM399_RS25745 (KM399_25720) | spoVAD | 4870838..4871854 (+) | 1017 | WP_000938967.1 | stage V sporulation protein AD | - |
| KM399_RS25750 (KM399_25725) | spoVAE | 4871851..4872201 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| KM399_RS25755 (KM399_25730) | - | 4872213..4872419 (+) | 207 | WP_000215915.1 | DUF1657 domain-containing protein | - |
| KM399_RS25760 (KM399_25735) | - | 4872440..4873309 (+) | 870 | WP_000018934.1 | DUF421 domain-containing protein | - |
| KM399_RS25765 (KM399_25740) | clpP | 4873551..4874132 (+) | 582 | WP_001049158.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21391.62 Da Isoelectric Point: 5.0423
>NTDB_id=573307 KM399_RS25765 WP_001049158.1 4873551..4874132(+) (clpP) [Bacillus anthracis strain UR-1]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEAMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEAMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=573307 KM399_RS25765 WP_001049158.1 4873551..4874132(+) (clpP) [Bacillus anthracis strain UR-1]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGTATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGCAATGATTCACCAACCACTTGGTGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGTATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGCAATGATTCACCAACCACTTGGTGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
89.583 |
99.482 |
0.891 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |