Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | KM414_RS25745 | Genome accession | NZ_CP076170 |
| Coordinates | 4873781..4874362 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049158.1 | Uniprot ID | - |
| Organism | Bacillus anthracis strain A168 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4827451..4874362 | 4873781..4874362 | within | 0 |
Gene organization within MGE regions
Location: 4827451..4874362
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KM414_RS25465 (KM414_25440) | speG | 4827451..4827966 (-) | 516 | WP_000076824.1 | spermidine N1-acetyltransferase | - |
| KM414_RS25470 (KM414_25445) | psiE | 4828110..4828514 (-) | 405 | WP_000834704.1 | phosphate-starvation-inducible protein PsiE | - |
| KM414_RS25475 (KM414_25450) | - | 4828564..4829526 (-) | 963 | WP_000635749.1 | nuclease-related domain-containing protein | - |
| KM414_RS25480 (KM414_25455) | - | 4829962..4830927 (+) | 966 | WP_001036602.1 | DUF4822 domain-containing protein | - |
| KM414_RS25485 (KM414_25460) | - | 4831152..4831904 (-) | 753 | WP_000590068.1 | siderophore ABC transporter ATP-binding protein | - |
| KM414_RS25490 (KM414_25465) | - | 4831901..4832965 (-) | 1065 | WP_000631132.1 | iron chelate uptake ABC transporter family permease subunit | - |
| KM414_RS25495 (KM414_25470) | - | 4832962..4833978 (-) | 1017 | WP_000042061.1 | ABC transporter permease | - |
| KM414_RS25500 (KM414_25475) | - | 4833998..4835011 (-) | 1014 | WP_000753441.1 | siderophore ABC transporter substrate-binding protein | - |
| KM414_RS25505 (KM414_25480) | - | 4835426..4836103 (-) | 678 | WP_001250248.1 | response regulator transcription factor | - |
| KM414_RS25515 (KM414_25490) | smpB | 4836992..4837459 (-) | 468 | WP_001123905.1 | SsrA-binding protein | - |
| KM414_RS25520 (KM414_25495) | rnr | 4837708..4840134 (-) | 2427 | WP_000391091.1 | ribonuclease R | - |
| KM414_RS25525 (KM414_25500) | estA | 4840277..4841017 (-) | 741 | WP_000761977.1 | carboxylesterase | - |
| KM414_RS25530 (KM414_25505) | secG | 4841179..4841412 (-) | 234 | WP_000557262.1 | preprotein translocase subunit SecG | - |
| KM414_RS25535 (KM414_25510) | - | 4841507..4842199 (-) | 693 | WP_000078306.1 | LrgB family protein | - |
| KM414_RS25540 (KM414_25515) | - | 4842196..4842564 (-) | 369 | WP_000673222.1 | CidA/LrgA family holin-like protein | - |
| KM414_RS25545 (KM414_25520) | - | 4842840..4843790 (+) | 951 | WP_001125043.1 | nucleoside hydrolase | - |
| KM414_RS28880 (KM414_25525) | - | 4843841..4843954 (-) | 114 | Protein_5006 | hypothetical protein | - |
| KM414_RS25550 (KM414_25530) | - | 4844278..4844790 (-) | 513 | WP_000422852.1 | hypothetical protein | - |
| KM414_RS25555 (KM414_25535) | - | 4844948..4845406 (-) | 459 | WP_000711928.1 | hypothetical protein | - |
| KM414_RS25560 (KM414_25540) | - | 4845823..4846632 (-) | 810 | WP_000639551.1 | NUMOD4 domain-containing protein | - |
| KM414_RS25565 (KM414_25545) | - | 4846807..4847436 (-) | 630 | WP_000142503.1 | hypothetical protein | - |
| KM414_RS25570 (KM414_25550) | - | 4847624..4847974 (-) | 351 | WP_000817546.1 | DUF2513 domain-containing protein | - |
| KM414_RS25575 (KM414_25555) | - | 4848119..4848595 (+) | 477 | WP_001003949.1 | hypothetical protein | - |
| KM414_RS25580 (KM414_25560) | - | 4848661..4848837 (-) | 177 | WP_000664412.1 | hypothetical protein | - |
| KM414_RS25585 (KM414_25565) | - | 4848834..4849046 (-) | 213 | WP_000660592.1 | hypothetical protein | - |
| KM414_RS25590 (KM414_25570) | - | 4849052..4849297 (-) | 246 | WP_001008127.1 | helix-turn-helix transcriptional regulator | - |
| KM414_RS25595 (KM414_25575) | - | 4849294..4849539 (-) | 246 | WP_000823894.1 | hypothetical protein | - |
| KM414_RS25600 (KM414_25580) | - | 4849692..4849895 (+) | 204 | WP_000502531.1 | hypothetical protein | - |
| KM414_RS25605 (KM414_25585) | - | 4849914..4850651 (+) | 738 | WP_000811954.1 | hypothetical protein | - |
| KM414_RS25610 (KM414_25590) | - | 4851062..4851253 (+) | 192 | WP_001001289.1 | hypothetical protein | - |
| KM414_RS25615 (KM414_25595) | - | 4851350..4851937 (+) | 588 | WP_000900865.1 | hypothetical protein | - |
| KM414_RS25620 (KM414_25600) | - | 4851930..4853501 (+) | 1572 | WP_003159006.1 | terminase TerL endonuclease subunit | - |
| KM414_RS25625 | - | 4853501..4853686 (+) | 186 | WP_000443127.1 | hypothetical protein | - |
| KM414_RS28885 (KM414_25605) | - | 4853652..4854044 (+) | 393 | WP_226992602.1 | HNH endonuclease | - |
| KM414_RS25635 (KM414_25610) | - | 4854461..4855771 (+) | 1311 | WP_000522484.1 | phage portal protein | - |
| KM414_RS25640 (KM414_25615) | - | 4855743..4856240 (+) | 498 | WP_003159003.1 | HK97 family phage prohead protease | - |
| KM414_RS25645 (KM414_25620) | - | 4856300..4857340 (+) | 1041 | WP_003159030.1 | phage major capsid protein | - |
| KM414_RS25650 (KM414_25625) | - | 4857427..4858407 (+) | 981 | WP_000168836.1 | phage major capsid protein | - |
| KM414_RS25655 (KM414_25630) | - | 4858475..4859341 (-) | 867 | WP_000348695.1 | hypothetical protein | - |
| KM414_RS25660 (KM414_25635) | - | 4859464..4860369 (-) | 906 | WP_000910235.1 | tyrosine-type recombinase/integrase | - |
| KM414_RS25665 (KM414_25640) | eno | 4860513..4861808 (-) | 1296 | WP_000103949.1 | phosphopyruvate hydratase | - |
| KM414_RS25670 (KM414_25645) | gpmI | 4861839..4863368 (-) | 1530 | WP_001231153.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| KM414_RS25675 (KM414_25650) | tpiA | 4863365..4864120 (-) | 756 | WP_001231039.1 | triose-phosphate isomerase | - |
| KM414_RS25680 (KM414_25655) | - | 4864153..4865337 (-) | 1185 | WP_001036337.1 | phosphoglycerate kinase | - |
| KM414_RS25685 (KM414_25660) | gap | 4865477..4866481 (-) | 1005 | WP_000161236.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| KM414_RS25690 (KM414_25665) | cggR | 4866508..4867536 (-) | 1029 | WP_001258187.1 | gapA transcriptional regulator CggR | - |
| KM414_RS25695 (KM414_25670) | - | 4867673..4867918 (-) | 246 | WP_000869728.1 | glutaredoxin family protein | - |
| KM414_RS25700 (KM414_25675) | rpoN | 4867928..4869235 (-) | 1308 | WP_000647981.1 | RNA polymerase factor sigma-54 | - |
| KM414_RS25710 (KM414_25685) | - | 4869775..4869981 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| KM414_RS25715 (KM414_25690) | - | 4870075..4870560 (+) | 486 | WP_001228539.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| KM414_RS25720 (KM414_25695) | spoVAC | 4870591..4871067 (+) | 477 | WP_000095399.1 | stage V sporulation protein AC | - |
| KM414_RS25725 (KM414_25700) | spoVAD | 4871068..4872084 (+) | 1017 | WP_000938967.1 | stage V sporulation protein AD | - |
| KM414_RS25730 (KM414_25705) | spoVAE | 4872081..4872431 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| KM414_RS25735 (KM414_25710) | - | 4872443..4872649 (+) | 207 | WP_000215915.1 | DUF1657 domain-containing protein | - |
| KM414_RS25740 (KM414_25715) | - | 4872670..4873539 (+) | 870 | WP_000018934.1 | DUF421 domain-containing protein | - |
| KM414_RS25745 (KM414_25720) | clpP | 4873781..4874362 (+) | 582 | WP_001049158.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21391.62 Da Isoelectric Point: 5.0423
>NTDB_id=572932 KM414_RS25745 WP_001049158.1 4873781..4874362(+) (clpP) [Bacillus anthracis strain A168]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEAMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEAMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=572932 KM414_RS25745 WP_001049158.1 4873781..4874362(+) (clpP) [Bacillus anthracis strain A168]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGTATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGCAATGATTCACCAACCACTTGGTGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGTATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGCAATGATTCACCAACCACTTGGTGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
89.583 |
99.482 |
0.891 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |