Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | KM415_RS25700 | Genome accession | NZ_CP076164 |
| Coordinates | 4873285..4873866 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049158.1 | Uniprot ID | - |
| Organism | Bacillus anthracis strain A193a | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4826955..4873866 | 4873285..4873866 | within | 0 |
Gene organization within MGE regions
Location: 4826955..4873866
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KM415_RS25425 (KM415_25415) | speG | 4826955..4827470 (-) | 516 | WP_000076824.1 | spermidine N1-acetyltransferase | - |
| KM415_RS25430 (KM415_25420) | psiE | 4827614..4828018 (-) | 405 | WP_000834704.1 | phosphate-starvation-inducible protein PsiE | - |
| KM415_RS25435 (KM415_25425) | - | 4828068..4829030 (-) | 963 | WP_000635749.1 | nuclease-related domain-containing protein | - |
| KM415_RS25440 (KM415_25430) | - | 4829466..4830431 (+) | 966 | WP_001036602.1 | DUF4822 domain-containing protein | - |
| KM415_RS25445 (KM415_25435) | - | 4830656..4831408 (-) | 753 | WP_000590068.1 | siderophore ABC transporter ATP-binding protein | - |
| KM415_RS25450 (KM415_25440) | - | 4831405..4832469 (-) | 1065 | WP_000631132.1 | iron chelate uptake ABC transporter family permease subunit | - |
| KM415_RS25455 (KM415_25445) | - | 4832466..4833482 (-) | 1017 | WP_000042061.1 | ABC transporter permease | - |
| KM415_RS25460 (KM415_25450) | - | 4833502..4834515 (-) | 1014 | WP_000753441.1 | siderophore ABC transporter substrate-binding protein | - |
| KM415_RS25465 (KM415_25455) | - | 4834930..4835607 (-) | 678 | WP_001250248.1 | response regulator transcription factor | - |
| KM415_RS25475 (KM415_25465) | smpB | 4836496..4836963 (-) | 468 | WP_001123905.1 | SsrA-binding protein | - |
| KM415_RS25480 (KM415_25470) | rnr | 4837212..4839638 (-) | 2427 | WP_000391091.1 | ribonuclease R | - |
| KM415_RS25485 (KM415_25475) | estA | 4839781..4840521 (-) | 741 | WP_000761977.1 | carboxylesterase | - |
| KM415_RS25490 (KM415_25480) | secG | 4840683..4840916 (-) | 234 | WP_000557262.1 | preprotein translocase subunit SecG | - |
| KM415_RS25495 (KM415_25485) | - | 4841011..4841703 (-) | 693 | WP_000078306.1 | LrgB family protein | - |
| KM415_RS25500 (KM415_25490) | - | 4841700..4842068 (-) | 369 | WP_000673222.1 | CidA/LrgA family holin-like protein | - |
| KM415_RS25505 (KM415_25495) | - | 4842344..4843294 (+) | 951 | WP_001125043.1 | nucleoside hydrolase | - |
| KM415_RS28800 (KM415_25500) | - | 4843345..4843458 (-) | 114 | Protein_4994 | hypothetical protein | - |
| KM415_RS25510 (KM415_25505) | - | 4843782..4844294 (-) | 513 | WP_000422852.1 | hypothetical protein | - |
| KM415_RS25515 (KM415_25510) | - | 4844452..4844910 (-) | 459 | WP_000711928.1 | hypothetical protein | - |
| KM415_RS25520 (KM415_25515) | - | 4845327..4846136 (-) | 810 | WP_000639551.1 | NUMOD4 domain-containing protein | - |
| KM415_RS25525 (KM415_25520) | - | 4846311..4846940 (-) | 630 | WP_000142503.1 | hypothetical protein | - |
| KM415_RS25530 (KM415_25525) | - | 4847128..4847478 (-) | 351 | WP_000817546.1 | DUF2513 domain-containing protein | - |
| KM415_RS25535 (KM415_25530) | - | 4847623..4848099 (+) | 477 | WP_001003949.1 | hypothetical protein | - |
| KM415_RS25540 (KM415_25535) | - | 4848165..4848341 (-) | 177 | WP_000664412.1 | hypothetical protein | - |
| KM415_RS25545 (KM415_25540) | - | 4848338..4848550 (-) | 213 | WP_000660592.1 | hypothetical protein | - |
| KM415_RS25550 (KM415_25545) | - | 4848556..4848801 (-) | 246 | WP_001008127.1 | helix-turn-helix transcriptional regulator | - |
| KM415_RS25555 (KM415_25550) | - | 4848798..4849043 (-) | 246 | WP_000823894.1 | hypothetical protein | - |
| KM415_RS25560 (KM415_25555) | - | 4849196..4849399 (+) | 204 | WP_000502531.1 | hypothetical protein | - |
| KM415_RS25565 (KM415_25560) | - | 4849418..4850155 (+) | 738 | WP_000811954.1 | hypothetical protein | - |
| KM415_RS25570 (KM415_25565) | - | 4850566..4850757 (+) | 192 | WP_001001289.1 | hypothetical protein | - |
| KM415_RS25575 (KM415_25570) | - | 4850854..4851441 (+) | 588 | WP_000900865.1 | hypothetical protein | - |
| KM415_RS25580 (KM415_25575) | - | 4851434..4853005 (+) | 1572 | WP_003159006.1 | terminase TerL endonuclease subunit | - |
| KM415_RS28805 (KM415_25580) | - | 4853156..4853548 (+) | 393 | WP_226992602.1 | HNH endonuclease | - |
| KM415_RS25590 (KM415_25585) | - | 4853965..4855275 (+) | 1311 | WP_000522484.1 | phage portal protein | - |
| KM415_RS25595 (KM415_25590) | - | 4855247..4855744 (+) | 498 | WP_003159003.1 | HK97 family phage prohead protease | - |
| KM415_RS25600 (KM415_25595) | - | 4855804..4856844 (+) | 1041 | WP_003159030.1 | phage major capsid protein | - |
| KM415_RS25605 (KM415_25600) | - | 4856931..4857911 (+) | 981 | WP_000168836.1 | phage major capsid protein | - |
| KM415_RS25610 (KM415_25605) | - | 4857979..4858845 (-) | 867 | WP_000348695.1 | hypothetical protein | - |
| KM415_RS25615 (KM415_25610) | - | 4858968..4859873 (-) | 906 | WP_000910235.1 | tyrosine-type recombinase/integrase | - |
| KM415_RS25620 (KM415_25615) | eno | 4860017..4861312 (-) | 1296 | WP_000103949.1 | phosphopyruvate hydratase | - |
| KM415_RS25625 (KM415_25620) | gpmI | 4861343..4862872 (-) | 1530 | WP_001231153.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| KM415_RS25630 (KM415_25625) | tpiA | 4862869..4863624 (-) | 756 | WP_001231039.1 | triose-phosphate isomerase | - |
| KM415_RS25635 (KM415_25630) | - | 4863657..4864841 (-) | 1185 | WP_001036337.1 | phosphoglycerate kinase | - |
| KM415_RS25640 (KM415_25635) | gap | 4864981..4865985 (-) | 1005 | WP_000161236.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| KM415_RS25645 (KM415_25640) | cggR | 4866012..4867040 (-) | 1029 | WP_001258187.1 | gapA transcriptional regulator CggR | - |
| KM415_RS25650 (KM415_25645) | - | 4867177..4867422 (-) | 246 | WP_000869728.1 | glutaredoxin family protein | - |
| KM415_RS25655 (KM415_25650) | rpoN | 4867432..4868739 (-) | 1308 | WP_000647981.1 | RNA polymerase factor sigma-54 | - |
| KM415_RS25665 (KM415_25660) | - | 4869279..4869485 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| KM415_RS25670 (KM415_25665) | - | 4869579..4870064 (+) | 486 | WP_001228539.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| KM415_RS25675 (KM415_25670) | spoVAC | 4870095..4870571 (+) | 477 | WP_000095399.1 | stage V sporulation protein AC | - |
| KM415_RS25680 (KM415_25675) | spoVAD | 4870572..4871588 (+) | 1017 | WP_000938967.1 | stage V sporulation protein AD | - |
| KM415_RS25685 (KM415_25680) | spoVAE | 4871585..4871935 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| KM415_RS25690 (KM415_25685) | - | 4871947..4872153 (+) | 207 | WP_000215915.1 | DUF1657 domain-containing protein | - |
| KM415_RS25695 (KM415_25690) | - | 4872174..4873043 (+) | 870 | WP_000018934.1 | DUF421 domain-containing protein | - |
| KM415_RS25700 (KM415_25695) | clpP | 4873285..4873866 (+) | 582 | WP_001049158.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21391.62 Da Isoelectric Point: 5.0423
>NTDB_id=572838 KM415_RS25700 WP_001049158.1 4873285..4873866(+) (clpP) [Bacillus anthracis strain A193a]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEAMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEAMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=572838 KM415_RS25700 WP_001049158.1 4873285..4873866(+) (clpP) [Bacillus anthracis strain A193a]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGTATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGCAATGATTCACCAACCACTTGGTGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGTATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCTGAAAAAGATATTCATATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCGCAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGCAATGATTCACCAACCACTTGGTGGGGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCTAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAGATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
89.583 |
99.482 |
0.891 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |