Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M1GAS476_RS07055 | Genome accession | NC_020540 |
| Coordinates | 1404119..1404298 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes M1 476 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1396237..1444735 | 1404119..1404298 | within | 0 |
Gene organization within MGE regions
Location: 1396237..1444735
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1GAS476_RS07015 (M1GAS476_1485) | - | 1396237..1396671 (-) | 435 | WP_010922579.1 | CopY/TcrY family copper transport repressor | - |
| M1GAS476_RS07020 (M1GAS476_1486) | - | 1396855..1397829 (+) | 975 | WP_227869327.1 | alpha/beta hydrolase fold domain-containing protein | - |
| M1GAS476_RS07025 (M1GAS476_1487) | rbfA | 1397963..1398313 (-) | 351 | WP_002994317.1 | 30S ribosome-binding factor RbfA | - |
| M1GAS476_RS07030 (M1GAS476_1488) | infB | 1398518..1401379 (-) | 2862 | WP_015446271.1 | translation initiation factor IF-2 | - |
| M1GAS476_RS07035 (M1GAS476_148) | - | 1401399..1401701 (-) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| M1GAS476_RS07040 (M1GAS476_149) | rnpM | 1401694..1401990 (-) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| M1GAS476_RS07045 (M1GAS476_1491) | nusA | 1402006..1403163 (-) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| M1GAS476_RS07050 (M1GAS476_1492) | rimP | 1403338..1403874 (-) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| M1GAS476_RS07055 | prx | 1404119..1404298 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| M1GAS476_RS07060 (M1GAS476_1494) | sda1 | 1404537..1405709 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| M1GAS476_RS07065 (M1GAS476_1495) | - | 1405825..1407021 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| M1GAS476_RS07075 | - | 1407132..1407317 (-) | 186 | WP_002988802.1 | holin | - |
| M1GAS476_RS07080 (M1GAS476_1497) | - | 1407314..1407613 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| M1GAS476_RS07085 (M1GAS476_1498) | - | 1407624..1408244 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| M1GAS476_RS09875 | - | 1408247..1408408 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| M1GAS476_RS07090 (M1GAS476_1500) | - | 1408417..1410324 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| M1GAS476_RS07095 | - | 1410335..1410970 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| M1GAS476_RS07100 | - | 1410970..1412025 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| M1GAS476_RS07105 | - | 1412022..1414004 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| M1GAS476_RS07110 (M1GAS476_1504) | - | 1414014..1414856 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| M1GAS476_RS07115 (M1GAS476_1505) | - | 1414868..1419250 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| M1GAS476_RS07120 (M1GAS476_1506) | - | 1419265..1419498 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| M1GAS476_RS07125 (M1GAS476_1507) | - | 1419573..1420028 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| M1GAS476_RS07130 (M1GAS476_1508) | - | 1420082..1420681 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| M1GAS476_RS07135 (M1GAS476_1509) | - | 1420693..1421052 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| M1GAS476_RS07140 | - | 1421056..1421400 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M1GAS476_RS07145 | - | 1421397..1421675 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| M1GAS476_RS07150 | - | 1421686..1422042 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| M1GAS476_RS07155 (M1GAS476_1513) | - | 1422054..1422941 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| M1GAS476_RS07160 (M1GAS476_1514) | - | 1422954..1423523 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| M1GAS476_RS07165 (M1GAS476_1515) | - | 1423679..1423945 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| M1GAS476_RS07170 | - | 1423948..1424136 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| M1GAS476_RS07175 | - | 1424167..1425612 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| M1GAS476_RS07180 | - | 1425572..1427104 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| M1GAS476_RS07185 | - | 1427120..1428397 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| M1GAS476_RS07190 (M1GAS476_152) | - | 1428387..1428839 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| M1GAS476_RS07195 (M1GAS476_1521) | - | 1428929..1429345 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| M1GAS476_RS07200 | - | 1429342..1429533 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| M1GAS476_RS07205 | - | 1429523..1430374 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| M1GAS476_RS07210 | - | 1430383..1430649 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| M1GAS476_RS09880 | - | 1430646..1430813 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| M1GAS476_RS07215 | - | 1430814..1432136 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| M1GAS476_RS07220 | - | 1432133..1432408 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| M1GAS476_RS07225 (M1GAS476_1528) | - | 1432795..1435179 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| M1GAS476_RS07230 (M1GAS476_1529) | - | 1435184..1437106 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| M1GAS476_RS07235 (M1GAS476_1530) | - | 1437149..1437706 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| M1GAS476_RS07240 (M1GAS476_1531) | - | 1437717..1438115 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| M1GAS476_RS07245 (M1GAS476_1532) | - | 1438119..1439273 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| M1GAS476_RS07250 (M1GAS476_1533) | - | 1439273..1439572 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| M1GAS476_RS07255 | - | 1439660..1439863 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| M1GAS476_RS07260 (M1GAS476_1535) | - | 1440009..1440395 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| M1GAS476_RS07265 | - | 1440392..1440595 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| M1GAS476_RS09885 | - | 1440588..1440758 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| M1GAS476_RS07270 | - | 1440755..1441030 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| M1GAS476_RS07275 | - | 1441092..1441307 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| M1GAS476_RS07280 (M1GAS476_1540) | - | 1441355..1441768 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| M1GAS476_RS09890 | - | 1441749..1441904 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| M1GAS476_RS07285 (M1GAS476_1542) | - | 1442230..1442580 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| M1GAS476_RS07290 (M1GAS476_1543) | - | 1442594..1442977 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M1GAS476_RS07295 (M1GAS476_1544) | - | 1442988..1443539 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| M1GAS476_RS07300 (M1GAS476_1545) | - | 1443656..1444735 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=57103 M1GAS476_RS07055 WP_002988813.1 1404119..1404298(-) (prx) [Streptococcus pyogenes M1 476]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=57103 M1GAS476_RS07055 WP_002988813.1 1404119..1404298(-) (prx) [Streptococcus pyogenes M1 476]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |