Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | M1GAS476_RS05815 | Genome accession | NC_020540 |
| Coordinates | 1164442..1164624 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes M1 476 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1164442..1197928 | 1164442..1164624 | within | 0 |
Gene organization within MGE regions
Location: 1164442..1197928
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1GAS476_RS05815 | prx | 1164442..1164624 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| M1GAS476_RS05820 (M1GAS476_1231) | sda3 | 1164863..1165663 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| M1GAS476_RS05825 (M1GAS476_1232) | - | 1165934..1166368 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| M1GAS476_RS05830 (M1GAS476_1233) | - | 1166438..1167643 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| M1GAS476_RS05840 | - | 1167759..1167986 (-) | 228 | WP_003058873.1 | phage holin | - |
| M1GAS476_RS05845 | - | 1167983..1168258 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| M1GAS476_RS05850 (M1GAS476_1236) | - | 1168268..1168885 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| M1GAS476_RS05855 (M1GAS476_1237) | - | 1168882..1169319 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| M1GAS476_RS05860 (M1GAS476_1238) | - | 1169331..1171199 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| M1GAS476_RS05865 (M1GAS476_1240) | - | 1171196..1171891 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| M1GAS476_RS05870 (M1GAS476_1241) | - | 1171888..1174245 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| M1GAS476_RS05875 (M1GAS476_1242) | - | 1174245..1174616 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| M1GAS476_RS05880 | - | 1174631..1174894 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| M1GAS476_RS05885 (M1GAS476_1244) | - | 1174905..1175498 (-) | 594 | WP_010922456.1 | tail protein | - |
| M1GAS476_RS05890 (M1GAS476_1245) | - | 1175510..1175845 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| M1GAS476_RS05895 | - | 1175846..1176082 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| M1GAS476_RS05900 (M1GAS476_1247) | - | 1176075..1176413 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| M1GAS476_RS05905 (M1GAS476_1248) | - | 1176373..1176795 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| M1GAS476_RS05910 | - | 1176805..1177005 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| M1GAS476_RS05915 (M1GAS476_1251) | - | 1177005..1177916 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| M1GAS476_RS05920 (M1GAS476_1252) | - | 1177941..1178402 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| M1GAS476_RS05925 (M1GAS476_1253) | - | 1178483..1179898 (-) | 1416 | WP_011285619.1 | terminase | - |
| M1GAS476_RS05930 | - | 1180008..1180274 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| M1GAS476_RS05935 | - | 1180267..1180446 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| M1GAS476_RS05940 | - | 1180496..1180720 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| M1GAS476_RS05945 (M1GAS476_1257) | - | 1180726..1182219 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| M1GAS476_RS05950 (M1GAS476_1258) | - | 1182212..1183480 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| M1GAS476_RS05955 (M1GAS476_1259) | - | 1183477..1183833 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| M1GAS476_RS05960 (M1GAS476_1939) | - | 1183982..1184326 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| M1GAS476_RS05965 (M1GAS476_1260) | - | 1184435..1184854 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| M1GAS476_RS05970 (M1GAS476_1261) | - | 1185122..1185757 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| M1GAS476_RS05975 | - | 1185759..1186028 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| M1GAS476_RS05980 (M1GAS476_1263) | - | 1186112..1186624 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| M1GAS476_RS05985 (M1GAS476_1264) | - | 1186621..1186962 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| M1GAS476_RS09855 | - | 1187140..1187307 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| M1GAS476_RS05990 (M1GAS476_1266) | - | 1187317..1188114 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| M1GAS476_RS05995 (M1GAS476_1267) | - | 1188111..1189040 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| M1GAS476_RS06000 (M1GAS476_1268) | - | 1189043..1189372 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| M1GAS476_RS06005 | - | 1189428..1189634 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| M1GAS476_RS09860 | - | 1189643..1189783 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| M1GAS476_RS06010 | - | 1189780..1190013 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| M1GAS476_RS06015 (M1GAS476_1271) | - | 1189994..1190383 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| M1GAS476_RS10030 (M1GAS476_1272) | - | 1190528..1190767 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| M1GAS476_RS06025 | - | 1190867..1191052 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| M1GAS476_RS06030 (M1GAS476_1274) | - | 1191054..1191365 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| M1GAS476_RS06035 | - | 1191443..1191628 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| M1GAS476_RS06040 | - | 1191795..1192034 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| M1GAS476_RS06045 (M1GAS476_1277) | - | 1192176..1192982 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| M1GAS476_RS09455 | - | 1192917..1193183 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| M1GAS476_RS06050 (M1GAS476_1279) | - | 1193215..1193931 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| M1GAS476_RS06055 | - | 1193943..1194134 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| M1GAS476_RS09460 | - | 1194770..1194865 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| M1GAS476_RS06060 (M1GAS476_1282) | - | 1195288..1195635 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| M1GAS476_RS06065 (M1GAS476_1283) | - | 1195639..1196019 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M1GAS476_RS06070 (M1GAS476_1284) | - | 1196031..1196297 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| M1GAS476_RS06075 (M1GAS476_1285) | - | 1196421..1197563 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| M1GAS476_RS06080 | - | 1197653..1197928 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=57096 M1GAS476_RS05815 WP_011017964.1 1164442..1164624(-) (prx) [Streptococcus pyogenes M1 476]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=57096 M1GAS476_RS05815 WP_011017964.1 1164442..1164624(-) (prx) [Streptococcus pyogenes M1 476]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |