Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M1GAS476_RS04985 | Genome accession | NC_020540 |
| Coordinates | 1002701..1002889 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes M1 476 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 995117..1041427 | 1002701..1002889 | within | 0 |
Gene organization within MGE regions
Location: 995117..1041427
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1GAS476_RS04955 (M1GAS476_1044) | pfkA | 995117..996130 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| M1GAS476_RS04960 (M1GAS476_1045) | - | 996210..999320 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| M1GAS476_RS04965 (M1GAS476_1046) | - | 999505..999876 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| M1GAS476_RS04970 (M1GAS476_1047) | - | 999876..1000574 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| M1GAS476_RS04975 (M1GAS476_1049) | - | 1000584..1001369 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| M1GAS476_RS04980 (M1GAS476_1050) | - | 1001496..1002110 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| M1GAS476_RS04985 | prx | 1002701..1002889 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| M1GAS476_RS04990 (M1GAS476_1053) | speA | 1003109..1003864 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| M1GAS476_RS04995 (M1GAS476_1054) | - | 1003986..1004645 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| M1GAS476_RS05000 | - | 1004645..1004866 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| M1GAS476_RS05005 (M1GAS476_1056) | - | 1004876..1005649 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| M1GAS476_RS05010 (M1GAS476_1057) | - | 1005660..1006262 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| M1GAS476_RS05015 (M1GAS476_1058) | - | 1006274..1007038 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| M1GAS476_RS05020 (M1GAS476_1059) | - | 1007040..1007372 (-) | 333 | WP_011285562.1 | phage holin | - |
| M1GAS476_RS05025 (M1GAS476_1060) | - | 1007372..1007695 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| M1GAS476_RS10085 | - | 1007709..1007831 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| M1GAS476_RS05035 (M1GAS476_1062) | - | 1007845..1008192 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| M1GAS476_RS05040 (M1GAS476_1063) | - | 1008203..1010065 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| M1GAS476_RS05045 (M1GAS476_1064) | - | 1010070..1013510 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| M1GAS476_RS05050 (M1GAS476_1065) | - | 1013511..1014995 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| M1GAS476_RS05055 (M1GAS476_1066) | - | 1014996..1016801 (-) | 1806 | WP_011054802.1 | tail protein | - |
| M1GAS476_RS05060 (M1GAS476_1068) | - | 1016794..1017252 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| M1GAS476_RS05065 (M1GAS476_1069) | - | 1017225..1017542 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| M1GAS476_RS05070 (M1GAS476_1070) | - | 1017555..1018061 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| M1GAS476_RS05075 (M1GAS476_1071) | - | 1018073..1018483 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| M1GAS476_RS05080 (M1GAS476_1072) | - | 1018485..1018880 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| M1GAS476_RS05085 (M1GAS476_1073) | - | 1018877..1019188 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| M1GAS476_RS05090 (M1GAS476_1937) | - | 1019185..1019529 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| M1GAS476_RS05095 | - | 1019543..1019836 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| M1GAS476_RS05100 (M1GAS476_1076) | - | 1019849..1020739 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| M1GAS476_RS05105 (M1GAS476_1077) | - | 1020758..1021327 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| M1GAS476_RS10090 | - | 1021436..1021570 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| M1GAS476_RS05110 | - | 1021572..1021841 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| M1GAS476_RS05115 (M1GAS476_1080) | - | 1021848..1022756 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| M1GAS476_RS05120 (M1GAS476_1081) | - | 1022725..1024050 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| M1GAS476_RS05125 (M1GAS476_1082) | - | 1024050..1025324 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| M1GAS476_RS05130 (M1GAS476_1083) | - | 1025314..1025694 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| M1GAS476_RS05135 (M1GAS476_1084) | - | 1026304..1026738 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M1GAS476_RS05140 (M1GAS476_1085) | - | 1027024..1027290 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| M1GAS476_RS05145 (M1GAS476_1086) | - | 1027287..1027811 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| M1GAS476_RS05150 (M1GAS476_1087) | - | 1027814..1028446 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| M1GAS476_RS05155 (M1GAS476_1089) | - | 1028448..1028732 (-) | 285 | WP_015446202.1 | hypothetical protein | - |
| M1GAS476_RS09835 | - | 1028729..1028899 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| M1GAS476_RS05160 | - | 1028896..1029132 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| M1GAS476_RS10125 | - | 1029132..1029377 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| M1GAS476_RS05170 (M1GAS476_1092) | - | 1029374..1029730 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| M1GAS476_RS05175 (M1GAS476_1093) | - | 1029727..1030167 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M1GAS476_RS05180 | - | 1030167..1030370 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| M1GAS476_RS05185 (M1GAS476_1095) | ssb | 1030376..1030801 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| M1GAS476_RS05190 (M1GAS476_1096) | - | 1030794..1031468 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| M1GAS476_RS05195 (M1GAS476_1097) | - | 1031469..1031951 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| M1GAS476_RS05200 | - | 1031973..1032227 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| M1GAS476_RS05205 (M1GAS476_1099) | - | 1032208..1032561 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| M1GAS476_RS05210 (M1GAS476_1101) | - | 1032702..1033484 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| M1GAS476_RS05215 (M1GAS476_1102) | - | 1033471..1034301 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| M1GAS476_RS10015 | - | 1034315..1034503 (-) | 189 | Protein_998 | XRE family transcriptional regulator | - |
| M1GAS476_RS10020 | - | 1034737..1034976 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| M1GAS476_RS05225 | - | 1035107..1035316 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| M1GAS476_RS05230 | - | 1035426..1035626 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| M1GAS476_RS05235 (M1GAS476_1106) | - | 1035700..1036086 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| M1GAS476_RS05240 | - | 1036075..1036284 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| M1GAS476_RS05245 (M1GAS476_1108) | - | 1036338..1036937 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| M1GAS476_RS09840 | - | 1036967..1037125 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| M1GAS476_RS05250 (M1GAS476_1110) | - | 1037482..1038306 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| M1GAS476_RS05255 (M1GAS476_1111) | - | 1038342..1039235 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| M1GAS476_RS05260 (M1GAS476_1112) | - | 1039356..1040444 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| M1GAS476_RS05265 (M1GAS476_1113) | - | 1040807..1041427 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=57092 M1GAS476_RS04985 WP_011285559.1 1002701..1002889(-) (prx) [Streptococcus pyogenes M1 476]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=57092 M1GAS476_RS04985 WP_011285559.1 1002701..1002889(-) (prx) [Streptococcus pyogenes M1 476]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |