Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | HD73_RS27665 | Genome accession | NC_020238 |
| Coordinates | 5280620..5281201 (+) | Length | 193 a.a. |
| NCBI ID | WP_001049162.1 | Uniprot ID | A0A9W5QPC2 |
| Organism | Bacillus thuringiensis serovar kurstaki str. HD73 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5233542..5281201 | 5280620..5281201 | within | 0 |
Gene organization within MGE regions
Location: 5233542..5281201
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HD73_RS27330 (HD73_5473) | - | 5233542..5233787 (-) | 246 | WP_000869730.1 | glutaredoxin family protein | - |
| HD73_RS27335 (HD73_5474) | rpoN | 5233797..5235104 (-) | 1308 | WP_000647955.1 | RNA polymerase factor sigma-54 | - |
| HD73_RS27340 (HD73_5475) | - | 5235667..5236494 (+) | 828 | WP_000412580.1 | helix-turn-helix domain-containing protein | - |
| HD73_RS27345 (HD73_5476) | - | 5236510..5236803 (-) | 294 | WP_001273481.1 | YolD-like family protein | - |
| HD73_RS27350 (HD73_5477) | - | 5236828..5237046 (-) | 219 | WP_001016121.1 | hypothetical protein | - |
| HD73_RS27355 (HD73_5478) | - | 5237190..5237756 (+) | 567 | WP_000742864.1 | hypothetical protein | - |
| HD73_RS27360 (HD73_5479) | - | 5237935..5238153 (-) | 219 | WP_000734384.1 | hypothetical protein | - |
| HD73_RS27365 (HD73_5480) | - | 5238153..5239268 (-) | 1116 | WP_000993515.1 | Rap family tetratricopeptide repeat protein | - |
| HD73_RS27370 (HD73_5481) | - | 5239472..5240407 (-) | 936 | WP_000405783.1 | N-acetylmuramoyl-L-alanine amidase | - |
| HD73_RS27375 (HD73_5482) | - | 5240407..5240832 (-) | 426 | WP_000532576.1 | phage holin family protein | - |
| HD73_RS27380 (HD73_5483) | - | 5241127..5242320 (+) | 1194 | WP_000499524.1 | IS110 family transposase | - |
| HD73_RS27385 | - | 5242441..5242813 (-) | 373 | Protein_5321 | hypothetical protein | - |
| HD73_RS27390 (HD73_5486) | - | 5242830..5247212 (-) | 4383 | WP_015382502.1 | phage tail spike protein | - |
| HD73_RS27395 (HD73_5487) | - | 5247209..5248678 (-) | 1470 | WP_015382503.1 | distal tail protein Dit | - |
| HD73_RS27400 (HD73_5488) | - | 5248720..5251101 (-) | 2382 | WP_002133928.1 | hypothetical protein | - |
| HD73_RS27405 (HD73_5489) | - | 5251379..5252614 (-) | 1236 | WP_000897021.1 | hypothetical protein | - |
| HD73_RS27410 (HD73_5491) | - | 5252845..5253207 (-) | 363 | WP_000415931.1 | hypothetical protein | - |
| HD73_RS27415 (HD73_5492) | - | 5253214..5253807 (-) | 594 | WP_001004920.1 | major tail protein | - |
| HD73_RS27420 | - | 5253808..5254143 (-) | 336 | WP_000219080.1 | hypothetical protein | - |
| HD73_RS27425 (HD73_5494) | - | 5254140..5254484 (-) | 345 | WP_000997537.1 | HK97 gp10 family phage protein | - |
| HD73_RS27430 (HD73_5495) | - | 5254486..5254836 (-) | 351 | WP_001247297.1 | phage head closure protein | - |
| HD73_RS27435 (HD73_5496) | - | 5254838..5255131 (-) | 294 | WP_000361981.1 | hypothetical protein | - |
| HD73_RS27440 (HD73_5497) | - | 5255144..5256286 (-) | 1143 | WP_086401347.1 | phage major capsid protein | - |
| HD73_RS27445 (HD73_5498) | - | 5256337..5257062 (-) | 726 | WP_000791073.1 | head maturation protease, ClpP-related | - |
| HD73_RS27450 (HD73_5499) | - | 5257052..5258203 (-) | 1152 | WP_000118683.1 | phage portal protein | - |
| HD73_RS27455 (HD73_5500) | - | 5258224..5259909 (-) | 1686 | WP_000595321.1 | terminase large subunit | - |
| HD73_RS27460 (HD73_5501) | - | 5259906..5260217 (-) | 312 | WP_000301150.1 | P27 family phage terminase small subunit | - |
| HD73_RS27465 (HD73_5502) | - | 5260342..5260677 (-) | 336 | WP_000666398.1 | HNH endonuclease | - |
| HD73_RS27470 (HD73_5503) | - | 5260643..5261017 (-) | 375 | WP_001177571.1 | hypothetical protein | - |
| HD73_RS27475 | - | 5261008..5261265 (-) | 258 | WP_000378699.1 | hypothetical protein | - |
| HD73_RS27480 (HD73_5504) | - | 5261272..5261481 (-) | 210 | WP_001177575.1 | hypothetical protein | - |
| HD73_RS27485 (HD73_5505) | - | 5261550..5261984 (-) | 435 | WP_001002014.1 | hypothetical protein | - |
| HD73_RS27490 (HD73_5506) | - | 5261990..5262193 (-) | 204 | WP_000343502.1 | hypothetical protein | - |
| HD73_RS27495 (HD73_5507) | - | 5262207..5262431 (-) | 225 | WP_000650576.1 | hypothetical protein | - |
| HD73_RS32410 | - | 5262668..5262793 (+) | 126 | WP_306426678.1 | type II toxin-antitoxin system HicA family toxin | - |
| HD73_RS27500 (HD73_5508) | - | 5262845..5263264 (+) | 420 | WP_000711194.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| HD73_RS27505 (HD73_5510) | - | 5263648..5264049 (-) | 402 | WP_015382504.1 | hypothetical protein | - |
| HD73_RS27510 | - | 5264087..5264413 (-) | 327 | WP_015670520.1 | hypothetical protein | - |
| HD73_RS27515 (HD73_5512) | recU | 5264410..5264937 (-) | 528 | WP_000540086.1 | Holliday junction resolvase RecU | - |
| HD73_RS27520 (HD73_5513) | - | 5264973..5265284 (-) | 312 | WP_000590881.1 | hypothetical protein | - |
| HD73_RS27525 (HD73_5514) | - | 5265329..5266024 (-) | 696 | WP_000858114.1 | hypothetical protein | - |
| HD73_RS27530 (HD73_5515) | - | 5266060..5266314 (-) | 255 | WP_000520932.1 | hypothetical protein | - |
| HD73_RS27535 (HD73_5516) | - | 5266397..5267190 (-) | 794 | Protein_5352 | prohibitin family protein | - |
| HD73_RS33495 (HD73_5518) | - | 5267192..5267332 (-) | 141 | WP_000492043.1 | hypothetical protein | - |
| HD73_RS27540 (HD73_5519) | - | 5267337..5267627 (-) | 291 | WP_001268031.1 | hypothetical protein | - |
| HD73_RS27545 (HD73_5520) | - | 5267686..5268120 (-) | 435 | WP_000775809.1 | hypothetical protein | - |
| HD73_RS27550 (HD73_5521) | - | 5268159..5268716 (-) | 558 | WP_001245738.1 | hypothetical protein | - |
| HD73_RS27555 (HD73_5522) | - | 5268740..5268970 (-) | 231 | WP_000139235.1 | hypothetical protein | - |
| HD73_RS27560 (HD73_5523) | - | 5268963..5269442 (-) | 480 | WP_000933908.1 | hypothetical protein | - |
| HD73_RS27565 (HD73_5524) | - | 5269454..5270407 (-) | 954 | WP_000510889.1 | DnaD domain protein | - |
| HD73_RS27570 | - | 5270501..5270842 (-) | 342 | WP_002133909.1 | hypothetical protein | - |
| HD73_RS27575 (HD73_5526) | - | 5270772..5270987 (-) | 216 | WP_000355713.1 | hypothetical protein | - |
| HD73_RS27580 (HD73_5527) | - | 5270987..5271700 (-) | 714 | WP_015382506.1 | hypothetical protein | - |
| HD73_RS27585 (HD73_5528) | - | 5271718..5272161 (-) | 444 | WP_000453495.1 | hypothetical protein | - |
| HD73_RS27590 (HD73_5529) | - | 5272188..5272376 (-) | 189 | WP_001187283.1 | hypothetical protein | - |
| HD73_RS27595 (HD73_5530) | - | 5272388..5273143 (-) | 756 | WP_001016247.1 | phage regulatory protein | - |
| HD73_RS33500 (HD73_5531) | - | 5273158..5273313 (-) | 156 | WP_000788383.1 | hypothetical protein | - |
| HD73_RS27600 (HD73_5532) | - | 5273497..5273730 (-) | 234 | WP_000711864.1 | DUF771 domain-containing protein | - |
| HD73_RS27605 (HD73_5533) | - | 5273766..5273996 (-) | 231 | WP_000216290.1 | helix-turn-helix transcriptional regulator | - |
| HD73_RS27610 (HD73_5534) | - | 5274161..5274553 (+) | 393 | WP_002133807.1 | helix-turn-helix transcriptional regulator | - |
| HD73_RS27615 (HD73_5535) | - | 5274564..5275031 (+) | 468 | WP_001037137.1 | hypothetical protein | - |
| HD73_RS27620 (HD73_5536) | - | 5275062..5276198 (+) | 1137 | WP_000135757.1 | tyrosine-type recombinase/integrase | - |
| HD73_RS27630 (HD73_5537) | - | 5276613..5276819 (+) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| HD73_RS27635 (HD73_5538) | - | 5276913..5277401 (+) | 489 | WP_001226064.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| HD73_RS27640 (HD73_5539) | spoVAC | 5277431..5277907 (+) | 477 | WP_000095408.1 | stage V sporulation protein AC | - |
| HD73_RS27645 (HD73_5540) | spoVAD | 5277908..5278924 (+) | 1017 | WP_000938972.1 | stage V sporulation protein AD | - |
| HD73_RS27650 (HD73_5541) | spoVAE | 5278921..5279271 (+) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| HD73_RS27655 (HD73_5542) | - | 5279283..5279489 (+) | 207 | WP_000215909.1 | DUF1657 domain-containing protein | - |
| HD73_RS27660 (HD73_5543) | - | 5279510..5280379 (+) | 870 | WP_000018924.1 | DUF421 domain-containing protein | - |
| HD73_RS27665 (HD73_5544) | clpP | 5280620..5281201 (+) | 582 | WP_001049162.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21419.67 Da Isoelectric Point: 5.0423
>NTDB_id=55961 HD73_RS27665 WP_001049162.1 5280620..5281201(+) (clpP) [Bacillus thuringiensis serovar kurstaki str. HD73]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=55961 HD73_RS27665 WP_001049162.1 5280620..5281201(+) (clpP) [Bacillus thuringiensis serovar kurstaki str. HD73]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
90.104 |
99.482 |
0.896 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |