Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KCL43_RS07985 | Genome accession | NZ_CP073275 |
| Coordinates | 1681649..1681834 (-) | Length | 61 a.a. |
| NCBI ID | WP_212573310.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain IN-6992 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1681649..1722414 | 1681649..1681834 | within | 0 |
Gene organization within MGE regions
Location: 1681649..1722414
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KCL43_RS07985 (KCL43_07985) | prx | 1681649..1681834 (-) | 186 | WP_212573310.1 | Paratox | Regulator |
| KCL43_RS07990 (KCL43_07990) | - | 1682132..1682485 (+) | 354 | WP_212573311.1 | hypothetical protein | - |
| KCL43_RS07995 (KCL43_07995) | - | 1682505..1682888 (+) | 384 | WP_212573312.1 | hypothetical protein | - |
| KCL43_RS08000 (KCL43_08000) | - | 1682872..1684131 (+) | 1260 | WP_212573313.1 | helicase-related protein | - |
| KCL43_RS08005 (KCL43_08005) | - | 1684115..1685410 (+) | 1296 | WP_212573314.1 | DUF3440 domain-containing protein | - |
| KCL43_RS08010 (KCL43_08010) | - | 1685394..1685906 (+) | 513 | WP_212573315.1 | IbrB-like domain-containing protein | - |
| KCL43_RS08015 (KCL43_08015) | - | 1685950..1686153 (+) | 204 | WP_212573316.1 | hypothetical protein | - |
| KCL43_RS08020 (KCL43_08020) | - | 1686617..1686970 (+) | 354 | WP_212573317.1 | hypothetical protein | - |
| KCL43_RS08025 (KCL43_08025) | - | 1686970..1687767 (+) | 798 | WP_212573318.1 | recombinase family protein | - |
| KCL43_RS08030 (KCL43_08030) | acrIIA3 | 1687928..1688281 (+) | 354 | WP_212573319.1 | anti-CRISPR protein AcrIIA3 | - |
| KCL43_RS08035 (KCL43_08035) | - | 1688298..1688954 (+) | 657 | WP_212573320.1 | hypothetical protein | - |
| KCL43_RS08040 (KCL43_08040) | - | 1689032..1690246 (-) | 1215 | WP_212573321.1 | glucosaminidase domain-containing protein | - |
| KCL43_RS08045 (KCL43_08045) | - | 1690357..1690542 (-) | 186 | WP_212573322.1 | hypothetical protein | - |
| KCL43_RS08050 (KCL43_08050) | - | 1690546..1690836 (-) | 291 | WP_212573323.1 | hypothetical protein | - |
| KCL43_RS08055 (KCL43_08055) | - | 1690849..1691460 (-) | 612 | WP_212573324.1 | hypothetical protein | - |
| KCL43_RS08060 (KCL43_08060) | - | 1691463..1691894 (-) | 432 | WP_212573325.1 | DUF1617 family protein | - |
| KCL43_RS08065 (KCL43_08065) | - | 1691903..1693804 (-) | 1902 | WP_212573326.1 | gp58-like family protein | - |
| KCL43_RS08070 (KCL43_08070) | - | 1693814..1694428 (-) | 615 | WP_212573327.1 | hypothetical protein | - |
| KCL43_RS08075 (KCL43_08075) | - | 1694430..1695104 (-) | 675 | WP_212573328.1 | collagen-like protein | - |
| KCL43_RS08080 (KCL43_08080) | - | 1695104..1697161 (-) | 2058 | WP_212573329.1 | phage tail spike protein | - |
| KCL43_RS08085 (KCL43_08085) | - | 1697158..1697928 (-) | 771 | WP_212573330.1 | distal tail protein Dit | - |
| KCL43_RS08090 (KCL43_08090) | - | 1697941..1702041 (-) | 4101 | WP_212573331.1 | phage tail tape measure protein | - |
| KCL43_RS08095 (KCL43_08095) | gpG | 1702267..1702569 (-) | 303 | WP_212573332.1 | phage tail assembly chaperone G | - |
| KCL43_RS08100 (KCL43_08100) | - | 1702662..1703237 (-) | 576 | WP_212573333.1 | major tail protein | - |
| KCL43_RS08105 (KCL43_08105) | - | 1703250..1703630 (-) | 381 | WP_212573334.1 | hypothetical protein | - |
| KCL43_RS08110 (KCL43_08110) | - | 1703623..1704021 (-) | 399 | WP_212573335.1 | HK97 gp10 family phage protein | - |
| KCL43_RS08115 (KCL43_08115) | - | 1704023..1704385 (-) | 363 | WP_212573336.1 | phage head-tail adapter protein | - |
| KCL43_RS08120 (KCL43_08120) | - | 1704378..1704686 (-) | 309 | WP_212573337.1 | hypothetical protein | - |
| KCL43_RS08125 (KCL43_08125) | - | 1704686..1704859 (-) | 174 | WP_212573338.1 | hypothetical protein | - |
| KCL43_RS08130 (KCL43_08130) | - | 1704870..1706003 (-) | 1134 | WP_212573339.1 | phage major capsid protein | - |
| KCL43_RS08135 (KCL43_08135) | - | 1706020..1706826 (-) | 807 | WP_212573340.1 | head maturation protease, ClpP-related | - |
| KCL43_RS08140 (KCL43_08140) | - | 1706807..1707994 (-) | 1188 | WP_212573341.1 | phage portal protein | - |
| KCL43_RS08145 (KCL43_08145) | - | 1708147..1708359 (-) | 213 | WP_228294450.1 | hypothetical protein | - |
| KCL43_RS08150 (KCL43_08150) | - | 1708362..1710092 (-) | 1731 | WP_212573342.1 | terminase large subunit domain-containing protein | - |
| KCL43_RS08155 (KCL43_08155) | - | 1710105..1710422 (-) | 318 | WP_015984806.1 | P27 family phage terminase small subunit | - |
| KCL43_RS08160 (KCL43_08160) | - | 1710565..1710870 (-) | 306 | WP_212573343.1 | HNH endonuclease | - |
| KCL43_RS08165 (KCL43_08165) | - | 1710863..1711249 (-) | 387 | WP_212573344.1 | hypothetical protein | - |
| KCL43_RS08170 (KCL43_08170) | - | 1711521..1712096 (-) | 576 | WP_212573345.1 | site-specific integrase | - |
| KCL43_RS08175 (KCL43_08175) | - | 1712199..1712600 (-) | 402 | WP_212573346.1 | transcriptional regulator | - |
| KCL43_RS08180 (KCL43_08180) | - | 1712603..1712818 (-) | 216 | WP_212573347.1 | crAss001_48 related protein | - |
| KCL43_RS08185 (KCL43_08185) | - | 1712835..1713503 (-) | 669 | WP_212573348.1 | DNA methyltransferase | - |
| KCL43_RS08190 (KCL43_08190) | - | 1713524..1714111 (-) | 588 | WP_212573349.1 | class I SAM-dependent methyltransferase | - |
| KCL43_RS08195 (KCL43_08195) | - | 1714115..1714342 (-) | 228 | WP_212573350.1 | hypothetical protein | - |
| KCL43_RS08200 (KCL43_08200) | - | 1714335..1714535 (-) | 201 | WP_212573351.1 | hypothetical protein | - |
| KCL43_RS08205 (KCL43_08205) | - | 1714532..1714831 (-) | 300 | WP_111678836.1 | VVA0879 family protein | - |
| KCL43_RS08210 (KCL43_08210) | - | 1714873..1715262 (-) | 390 | WP_111678017.1 | YopX family protein | - |
| KCL43_RS08215 (KCL43_08215) | - | 1715326..1715538 (-) | 213 | WP_212573352.1 | hypothetical protein | - |
| KCL43_RS08220 (KCL43_08220) | - | 1715547..1715687 (-) | 141 | WP_142240698.1 | hypothetical protein | - |
| KCL43_RS08225 (KCL43_08225) | - | 1715684..1715917 (-) | 234 | WP_212573353.1 | hypothetical protein | - |
| KCL43_RS08230 (KCL43_08230) | - | 1715898..1716281 (-) | 384 | WP_154803901.1 | DnaD domain-containing protein | - |
| KCL43_RS08235 (KCL43_08235) | - | 1716443..1716688 (-) | 246 | WP_012678836.1 | helix-turn-helix domain-containing protein | - |
| KCL43_RS08240 (KCL43_08240) | - | 1716892..1717095 (-) | 204 | WP_154388494.1 | hypothetical protein | - |
| KCL43_RS10550 | - | 1717049..1717204 (-) | 156 | WP_410177027.1 | BOW99_gp33 family protein | - |
| KCL43_RS08245 (KCL43_08245) | - | 1717354..1718070 (-) | 717 | WP_212573354.1 | polymer-forming cytoskeletal protein | - |
| KCL43_RS08250 (KCL43_08250) | - | 1718215..1718430 (-) | 216 | WP_212573355.1 | helix-turn-helix transcriptional regulator | - |
| KCL43_RS08255 (KCL43_08255) | - | 1718618..1719361 (+) | 744 | WP_212573356.1 | XRE family transcriptional regulator | - |
| KCL43_RS08260 (KCL43_08260) | - | 1719421..1719891 (+) | 471 | WP_043052995.1 | DUF6978 family protein | - |
| KCL43_RS08265 (KCL43_08265) | - | 1719917..1720693 (+) | 777 | WP_043052994.1 | DUF1828 domain-containing protein | - |
| KCL43_RS08270 (KCL43_08270) | - | 1720981..1722414 (+) | 1434 | WP_212573357.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6997.00 Da Isoelectric Point: 3.8258
>NTDB_id=558791 KCL43_RS07985 WP_212573310.1 1681649..1681834(-) (prx) [Streptococcus equi subsp. zooepidemicus strain IN-6992]
MLTYDEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPSEEVQPWEVVTVEAVADILNELQII
MLTYDEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPSEEVQPWEVVTVEAVADILNELQII
Nucleotide
Download Length: 186 bp
>NTDB_id=558791 KCL43_RS07985 WP_212573310.1 1681649..1681834(-) (prx) [Streptococcus equi subsp. zooepidemicus strain IN-6992]
ATGCTAACATACGATGAATTTAAGCAGGCTATTGATCATGGATATATCACAGGAGATGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAAGTGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
ATGCTAACATACGATGAATTTAAGCAGGCTATTGATCATGGATATATCACAGGAGATGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAAGTGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
95.082 |
0.721 |
| prx | Streptococcus pyogenes MGAS315 |
71.186 |
96.721 |
0.689 |
| prx | Streptococcus pyogenes MGAS8232 |
71.186 |
96.721 |
0.689 |
| prx | Streptococcus pyogenes MGAS315 |
68.966 |
95.082 |
0.656 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
67.213 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
68.852 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
67.213 |
0.492 |