Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | KCL43_RS02475 | Genome accession | NZ_CP073275 |
| Coordinates | 492619..492798 (+) | Length | 59 a.a. |
| NCBI ID | WP_165628645.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain IN-6992 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 450173..493921 | 492619..492798 | within | 0 |
Gene organization within MGE regions
Location: 450173..493921
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KCL43_RS02215 (KCL43_02215) | - | 450173..451570 (-) | 1398 | WP_206157612.1 | ISNCY family transposase | - |
| KCL43_RS02225 (KCL43_02225) | - | 451879..452958 (-) | 1080 | WP_165628393.1 | site-specific integrase | - |
| KCL43_RS02230 (KCL43_02230) | - | 453079..453567 (-) | 489 | WP_050322766.1 | hypothetical protein | - |
| KCL43_RS02235 (KCL43_02235) | - | 453594..454676 (-) | 1083 | WP_050322767.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KCL43_RS02240 (KCL43_02240) | - | 454677..455021 (-) | 345 | WP_080358139.1 | helix-turn-helix domain-containing protein | - |
| KCL43_RS02245 (KCL43_02245) | - | 455353..455517 (+) | 165 | WP_394350759.1 | XRE family transcriptional regulator | - |
| KCL43_RS02250 (KCL43_02250) | - | 455519..455704 (+) | 186 | WP_050322769.1 | helix-turn-helix domain-containing protein | - |
| KCL43_RS02255 (KCL43_02255) | - | 455706..456482 (+) | 777 | WP_050322770.1 | phage antirepressor | - |
| KCL43_RS02260 (KCL43_02260) | - | 456541..456828 (+) | 288 | WP_050322771.1 | DNA-binding protein | - |
| KCL43_RS02265 (KCL43_02265) | - | 456825..456995 (+) | 171 | WP_165628394.1 | hypothetical protein | - |
| KCL43_RS10505 | - | 456988..457188 (+) | 201 | WP_165628395.1 | hypothetical protein | - |
| KCL43_RS02270 (KCL43_02270) | - | 457194..457403 (+) | 210 | WP_165628396.1 | hypothetical protein | - |
| KCL43_RS02275 (KCL43_02275) | - | 457484..457798 (+) | 315 | WP_165628397.1 | hypothetical protein | - |
| KCL43_RS02280 (KCL43_02280) | - | 457798..458955 (+) | 1158 | WP_165628398.1 | DUF2800 domain-containing protein | - |
| KCL43_RS02285 (KCL43_02285) | - | 458968..459525 (+) | 558 | WP_165628399.1 | DUF2815 family protein | - |
| KCL43_RS02290 (KCL43_02290) | - | 459570..461492 (+) | 1923 | WP_165628400.1 | DNA polymerase | - |
| KCL43_RS02295 (KCL43_02295) | - | 461496..463892 (+) | 2397 | WP_165628401.1 | phage/plasmid primase, P4 family | - |
| KCL43_RS02300 (KCL43_02300) | - | 464279..464554 (+) | 276 | WP_165628516.1 | VRR-NUC domain-containing protein | - |
| KCL43_RS02305 (KCL43_02305) | - | 464551..465870 (+) | 1320 | WP_212573372.1 | SNF2-related protein | - |
| KCL43_RS02310 (KCL43_02310) | - | 465871..466038 (+) | 168 | WP_164714884.1 | hypothetical protein | - |
| KCL43_RS02315 (KCL43_02315) | - | 466035..466301 (+) | 267 | WP_165628514.1 | hypothetical protein | - |
| KCL43_RS02320 (KCL43_02320) | - | 466298..466933 (+) | 636 | WP_228294460.1 | DNA-methyltransferase | - |
| KCL43_RS02325 (KCL43_02325) | - | 467067..467480 (+) | 414 | WP_002983418.1 | transcriptional regulator | - |
| KCL43_RS02330 (KCL43_02330) | - | 467577..468029 (+) | 453 | WP_165628513.1 | terminase small subunit | - |
| KCL43_RS02335 (KCL43_02335) | - | 468019..469296 (+) | 1278 | WP_050322782.1 | PBSX family phage terminase large subunit | - |
| KCL43_RS02340 (KCL43_02340) | - | 469312..470844 (+) | 1533 | WP_212573373.1 | phage portal protein | - |
| KCL43_RS02345 (KCL43_02345) | - | 470804..472252 (+) | 1449 | WP_050322784.1 | minor capsid protein | - |
| KCL43_RS02350 (KCL43_02350) | - | 472280..472468 (+) | 189 | WP_165628510.1 | hypothetical protein | - |
| KCL43_RS02355 (KCL43_02355) | - | 472471..472737 (+) | 267 | WP_050322786.1 | hypothetical protein | - |
| KCL43_RS02360 (KCL43_02360) | - | 472893..473462 (+) | 570 | WP_050322787.1 | DUF4355 domain-containing protein | - |
| KCL43_RS02365 (KCL43_02365) | - | 473475..474362 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| KCL43_RS02370 (KCL43_02370) | - | 474374..474730 (+) | 357 | WP_002983431.1 | phage head-tail connector protein | - |
| KCL43_RS02375 (KCL43_02375) | - | 474741..475019 (+) | 279 | WP_043025009.1 | hypothetical protein | - |
| KCL43_RS02380 (KCL43_02380) | - | 475016..475360 (+) | 345 | WP_043025010.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KCL43_RS02385 (KCL43_02385) | - | 475364..475723 (+) | 360 | WP_002983439.1 | hypothetical protein | - |
| KCL43_RS02390 (KCL43_02390) | - | 475735..476334 (+) | 600 | WP_165628509.1 | phage major tail protein, TP901-1 family | - |
| KCL43_RS02395 (KCL43_02395) | - | 476388..476843 (+) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| KCL43_RS02400 (KCL43_02400) | - | 476918..477151 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| KCL43_RS02405 (KCL43_02405) | - | 477166..481323 (+) | 4158 | WP_165628508.1 | tape measure protein | - |
| KCL43_RS02410 (KCL43_02410) | - | 481335..482177 (+) | 843 | WP_212573374.1 | phage tail family protein | - |
| KCL43_RS02415 (KCL43_02415) | - | 482187..484169 (+) | 1983 | WP_165628506.1 | phage tail protein | - |
| KCL43_RS02420 (KCL43_02420) | - | 484169..484843 (+) | 675 | WP_165628505.1 | collagen-like protein | - |
| KCL43_RS02425 (KCL43_02425) | - | 484845..485459 (+) | 615 | WP_165628504.1 | hypothetical protein | - |
| KCL43_RS02430 (KCL43_02430) | - | 485473..487356 (+) | 1884 | WP_165628503.1 | gp58-like family protein | - |
| KCL43_RS02435 (KCL43_02435) | - | 487365..487796 (+) | 432 | WP_165628502.1 | DUF1617 family protein | - |
| KCL43_RS02440 (KCL43_02440) | - | 487799..488413 (+) | 615 | WP_165628501.1 | DUF1366 domain-containing protein | - |
| KCL43_RS02445 (KCL43_02445) | - | 488426..488716 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| KCL43_RS02450 (KCL43_02450) | - | 488719..488898 (+) | 180 | WP_012679339.1 | holin | - |
| KCL43_RS02455 (KCL43_02455) | - | 489019..490236 (+) | 1218 | WP_165628500.1 | peptidoglycan amidohydrolase family protein | - |
| KCL43_RS02460 (KCL43_02460) | - | 490577..490783 (+) | 207 | WP_165628499.1 | hypothetical protein | - |
| KCL43_RS02465 (KCL43_02465) | - | 490767..491180 (+) | 414 | WP_165628498.1 | DUF2335 domain-containing protein | - |
| KCL43_RS02470 (KCL43_02470) | - | 491696..492271 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| KCL43_RS02475 (KCL43_02475) | prx | 492619..492798 (+) | 180 | WP_165628645.1 | Paratox | Regulator |
| KCL43_RS02480 (KCL43_02480) | - | 493406..493921 (-) | 516 | WP_021320424.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6937.93 Da Isoelectric Point: 4.0232
>NTDB_id=558766 KCL43_RS02475 WP_165628645.1 492619..492798(+) (prx) [Streptococcus equi subsp. zooepidemicus strain IN-6992]
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVRTWEAVTMEVVEEVMRELE
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVRTWEAVTMEVVEEVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=558766 KCL43_RS02475 WP_165628645.1 492619..492798(+) (prx) [Streptococcus equi subsp. zooepidemicus strain IN-6992]
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAGAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAAGAGGTAAGGACGTGGGAGGCAGTGACAATGGAAGTGGTGGAAGAGG
TGATGAGAGAATTGGAGTAA
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAGAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAAGAGGTAAGGACGTGGGAGGCAGTGACAATGGAAGTGGTGGAAGAGG
TGATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
100 |
0.78 |
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS8232 |
72.414 |
98.305 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
71.186 |
100 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
69.492 |
0.593 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
71.186 |
0.593 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |