NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	J7W01_RS17960	Genome accession	NZ_CP072525
Coordinates	3474627..3475220 (+)	Length	197 a.a.
NCBI ID	WP_003228214.1	Uniprot ID	A0A199WEF2
Organism	Bacillus subtilis strain YB-04
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 3469627..3480220

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7W01_RS17930 (J7W01_17930)	aspP	3470599..3472161 (+)	1563	WP_003228228.1	aspartate/proton symporter AspP	-
J7W01_RS17935 (J7W01_17935)	-	3472256..3472840 (+)	585	WP_003244443.1	TetR family transcriptional regulator	-
J7W01_RS17940 (J7W01_17940)	psmA	3472923..3473258 (+)	336	WP_041850504.1	QacE family quaternary ammonium compound efflux SMR transporter	-
J7W01_RS17945 (J7W01_17945)	psmB	3473258..3473578 (+)	321	WP_003228222.1	QacE family quaternary ammonium compound efflux SMR transporter	-
J7W01_RS17950 (J7W01_17950)	yvdQ	3473614..3474126 (-)	513	WP_014478056.1	DUF3231 family protein	-
J7W01_RS17960 (J7W01_17960)	clpP	3474627..3475220 (+)	594	WP_003228214.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
J7W01_RS17965 (J7W01_17965)	pgmB	3475265..3475939 (-)	675	WP_041850503.1	beta-phosphoglucomutase	-
J7W01_RS17970 (J7W01_17970)	malL	3475936..3477621 (-)	1686	WP_041850502.1	oligo-1,6-glucosidase	-
J7W01_RS17975 (J7W01_17975)	mdxK	3477614..3479887 (-)	2274	WP_041850501.1	maltose phosphorylase	-

Sequence

Protein

Download Length: 197 a.a. Molecular weight: 21682.00 Da Isoelectric Point: 4.9416

                                >NTDB_id=553997 J7W01_RS17960 WP_003228214.1 3474627..3475220(+) (clpP) [Bacillus subtilis strain YB-04]

MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT

MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ

PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK

Nucleotide

Download Length: 594 bp

                                >NTDB_id=553997 J7W01_RS17960 WP_003228214.1 3474627..3475220(+) (clpP) [Bacillus subtilis strain YB-04]

ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGAGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA

TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG

AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC

ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG

CGAAAAAGGCAAACGCTATGCACTTCCAAACAGTGAAGTCATGATTCACCAGCCTCTTGGCGGTGCGCAAGGTCAAGCGA

CAGAAATTGAAATTGCTGCGAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTCCTAGCTGAACGTACTGGCCAG

CCGCTTGAAGTGATCGAACGTGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA

CAAAATTTTGACTCACACAGAAGACAAAAAGTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(13-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A199WEF2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	100	100	1
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	68.617	95.431	0.655
clpP	Streptococcus thermophilus LMG 18311	58.163	99.492	0.579
clpP	Streptococcus thermophilus LMD-9	58.163	99.492	0.579
clpP	Streptococcus pneumoniae D39	57.812	97.462	0.563
clpP	Streptococcus pneumoniae Rx1	57.812	97.462	0.563
clpP	Streptococcus pneumoniae R6	57.812	97.462	0.563
clpP	Streptococcus pneumoniae TIGR4	57.812	97.462	0.563
clpP	Lactococcus lactis subsp. cremoris KW2	57.895	96.447	0.558
clpP	Streptococcus pyogenes JRS4	56.122	99.492	0.558
clpP	Streptococcus pyogenes MGAS315	56.122	99.492	0.558
clpP	Streptococcus mutans UA159	54.822	100	0.548
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	55.789	96.447	0.538

Detailed information NTG0553997