Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | J7S31_RS06830 | Genome accession | NZ_CP072523 |
| Coordinates | 1329962..1330144 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SHZ-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1329962..1371465 | 1329962..1330144 | within | 0 |
Gene organization within MGE regions
Location: 1329962..1371465
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J7S31_RS06830 (J7S31_06805) | prx | 1329962..1330144 (-) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| J7S31_RS06835 (J7S31_06810) | - | 1330377..1331363 (+) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| J7S31_RS06840 (J7S31_06815) | - | 1331477..1331992 (-) | 516 | WP_023077389.1 | hypothetical protein | - |
| J7S31_RS06845 (J7S31_06820) | - | 1332314..1333516 (-) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| J7S31_RS06850 (J7S31_06825) | - | 1333632..1333859 (-) | 228 | WP_003058873.1 | phage holin | - |
| J7S31_RS06855 (J7S31_06830) | - | 1333856..1334128 (-) | 273 | WP_002986916.1 | hypothetical protein | - |
| J7S31_RS06860 (J7S31_06835) | - | 1334138..1334755 (-) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| J7S31_RS06865 (J7S31_06840) | - | 1334752..1335189 (-) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| J7S31_RS06870 (J7S31_06845) | - | 1335201..1337216 (-) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| J7S31_RS06875 (J7S31_06850) | - | 1337226..1338233 (-) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| J7S31_RS06880 (J7S31_06855) | - | 1338230..1340209 (-) | 1980 | WP_011054864.1 | phage tail protein | - |
| J7S31_RS06885 (J7S31_06860) | - | 1340219..1341061 (-) | 843 | WP_011054865.1 | phage tail family protein | - |
| J7S31_RS06890 (J7S31_06865) | - | 1341073..1345455 (-) | 4383 | WP_011054866.1 | tape measure protein | - |
| J7S31_RS06895 (J7S31_06870) | - | 1345470..1345703 (-) | 234 | WP_011054867.1 | hypothetical protein | - |
| J7S31_RS06900 (J7S31_06875) | - | 1345778..1346233 (-) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| J7S31_RS06905 (J7S31_06880) | - | 1346287..1346886 (-) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| J7S31_RS06910 (J7S31_06885) | - | 1346898..1347257 (-) | 360 | WP_011054870.1 | hypothetical protein | - |
| J7S31_RS06915 (J7S31_06890) | - | 1347261..1347605 (-) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| J7S31_RS06920 (J7S31_06895) | - | 1347602..1347880 (-) | 279 | WP_011054872.1 | hypothetical protein | - |
| J7S31_RS06925 (J7S31_06900) | - | 1347891..1348247 (-) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| J7S31_RS06930 (J7S31_06905) | - | 1348259..1349146 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| J7S31_RS06935 (J7S31_06910) | - | 1349159..1349728 (-) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| J7S31_RS06940 (J7S31_06915) | - | 1349896..1350162 (-) | 267 | WP_011054875.1 | hypothetical protein | - |
| J7S31_RS06945 (J7S31_06920) | - | 1350167..1350355 (-) | 189 | WP_011054876.1 | hypothetical protein | - |
| J7S31_RS06950 (J7S31_06925) | - | 1350383..1351831 (-) | 1449 | WP_011054877.1 | minor capsid protein | - |
| J7S31_RS06955 (J7S31_06930) | - | 1351791..1353323 (-) | 1533 | WP_011106638.1 | phage portal protein | - |
| J7S31_RS06960 (J7S31_06935) | - | 1353339..1354616 (-) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| J7S31_RS06965 (J7S31_06940) | - | 1354606..1355058 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| J7S31_RS06970 (J7S31_06945) | - | 1355148..1355564 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| J7S31_RS06975 (J7S31_06950) | - | 1355697..1355969 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| J7S31_RS06980 (J7S31_06955) | - | 1355962..1356132 (-) | 171 | WP_011054883.1 | hypothetical protein | - |
| J7S31_RS06985 (J7S31_06960) | - | 1356133..1357455 (-) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| J7S31_RS06990 (J7S31_06965) | - | 1357452..1357727 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| J7S31_RS06995 (J7S31_06970) | - | 1358093..1360477 (-) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| J7S31_RS07000 (J7S31_06975) | - | 1360482..1362404 (-) | 1923 | WP_011054887.1 | DNA polymerase | - |
| J7S31_RS07005 (J7S31_06980) | - | 1362447..1363010 (-) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| J7S31_RS07010 (J7S31_06985) | - | 1363024..1364181 (-) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| J7S31_RS07015 (J7S31_06990) | - | 1364181..1364480 (-) | 300 | WP_000573833.1 | hypothetical protein | - |
| J7S31_RS07020 (J7S31_06995) | - | 1364568..1364771 (-) | 204 | WP_011054890.1 | hypothetical protein | - |
| J7S31_RS07025 (J7S31_07000) | - | 1364970..1365299 (-) | 330 | WP_050428446.1 | hypothetical protein | - |
| J7S31_RS07030 (J7S31_07005) | - | 1365296..1365503 (-) | 208 | Protein_1336 | hypothetical protein | - |
| J7S31_RS07035 (J7S31_07010) | - | 1365496..1365666 (-) | 171 | WP_011054894.1 | hypothetical protein | - |
| J7S31_RS07040 (J7S31_07015) | - | 1365695..1365952 (-) | 258 | WP_011054895.1 | hypothetical protein | - |
| J7S31_RS07045 (J7S31_07020) | - | 1366040..1366240 (-) | 201 | WP_011184050.1 | hypothetical protein | - |
| J7S31_RS07050 (J7S31_07025) | - | 1366291..1366482 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| J7S31_RS07055 (J7S31_07030) | - | 1367121..1367471 (+) | 351 | WP_011184049.1 | helix-turn-helix transcriptional regulator | - |
| J7S31_RS07060 (J7S31_07035) | - | 1367485..1367868 (+) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| J7S31_RS07065 (J7S31_07040) | - | 1367879..1368430 (+) | 552 | WP_011054899.1 | hypothetical protein | - |
| J7S31_RS07070 (J7S31_07045) | - | 1368606..1369694 (+) | 1089 | WP_011054900.1 | site-specific integrase | - |
| J7S31_RS07075 (J7S31_07050) | - | 1369837..1371465 (-) | 1629 | WP_011054901.1 | ABC transporter permease | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=553877 J7S31_RS06830 WP_011054856.1 1329962..1330144(-) (prx) [Streptococcus pyogenes strain SHZ-1]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=553877 J7S31_RS06830 WP_011054856.1 1329962..1330144(-) (prx) [Streptococcus pyogenes strain SHZ-1]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |