Detailed information NTG0553360

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: J7T63_RS09035
• Genome accession: NZ_CP072442
• Coordinates: 1723990..1724418 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24726
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1718990..1729418

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T63_RS08995 (J7T63_08920)	-	1719128..1719571 (-)	444	WP_041829335.1	hypothetical protein	-
J7T63_RS09000	-	1719645..1719983 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
J7T63_RS09005 (J7T63_08930)	-	1720313..1720510 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
J7T63_RS09010 (J7T63_08935)	-	1720759..1721952 (-)	1194	WP_372429425.1	acetate kinase	-
J7T63_RS09015 (J7T63_08940)	comYH	1722008..1722964 (-)	957	WP_084831205.1	class I SAM-dependent methyltransferase	Machinery gene
J7T63_RS09020 (J7T63_08945)	comGG	1723009..1723326 (-)	318	WP_082309152.1	competence type IV pilus minor pilin ComGG	-
J7T63_RS09025 (J7T63_08950)	comYF	1723304..1723741 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T63_RS09030 (J7T63_08955)	comGE	1723725..1724018 (-)	294	WP_082309154.1	competence type IV pilus minor pilin ComGE	-
J7T63_RS09035 (J7T63_08960)	comYD	1723990..1724418 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T63_RS09040 (J7T63_08965)	comYC	1724378..1724704 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T63_RS09045 (J7T63_08970)	comGB	1724701..1725800 (-)	1100	Protein_1725	competence type IV pilus assembly protein ComGB	-
J7T63_RS09050 (J7T63_08975)	comGA/cglA/cilD	1725682..1726623 (-)	942	WP_071417491.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T63_RS09055 (J7T63_08980)	-	1726704..1727066 (-)	363	WP_014622006.1	DUF1033 family protein	-
J7T63_RS09060 (J7T63_08985)	-	1727336..1728585 (+)	1250	Protein_1728	ISL3 family transposase	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=553360 J7T63_RS09035 WP_011226626.1 1723990..1724418(-) (comYD) [Streptococcus thermophilus strain S24726]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=553360 J7T63_RS09035 WP_011226626.1 1723990..1724418(-) (comYD) [Streptococcus thermophilus strain S24726]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGATCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCTAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38