Detailed information NTG0553128

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: J7T69_RS09215
• Genome accession: NZ_CP072438
• Coordinates: 1781010..1781438 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24733
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1776010..1786438

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T69_RS09170 (J7T69_09120)	-	1776147..1776590 (-)	444	WP_011681680.1	hypothetical protein	-
J7T69_RS09175	-	1776664..1777089 (-)	426	WP_014608739.1	CPBP family intramembrane glutamic endopeptidase	-
J7T69_RS09180	-	1777046..1777321 (-)	276	WP_011681681.1	hypothetical protein	-
J7T69_RS09185 (J7T69_09130)	-	1777333..1777530 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
J7T69_RS09190 (J7T69_09135)	-	1777779..1778972 (-)	1194	WP_014608740.1	acetate kinase	-
J7T69_RS09195 (J7T69_09140)	comYH	1779028..1779984 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
J7T69_RS09200 (J7T69_09145)	comGG	1780029..1780346 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
J7T69_RS09205 (J7T69_09150)	comYF	1780324..1780761 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T69_RS09210 (J7T69_09155)	comGE	1780745..1781038 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
J7T69_RS09215 (J7T69_09160)	comYD	1781010..1781438 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T69_RS09220 (J7T69_09165)	comYC	1781398..1781724 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T69_RS09225 (J7T69_09170)	comYB	1781721..1782821 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7T69_RS09230 (J7T69_09175)	comGA/cglA/cilD	1782703..1783644 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T69_RS09235 (J7T69_09180)	-	1783725..1784087 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=553128 J7T69_RS09215 WP_011226626.1 1781010..1781438(-) (comYD) [Streptococcus thermophilus strain S24733]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=553128 J7T69_RS09215 WP_011226626.1 1781010..1781438(-) (comYD) [Streptococcus thermophilus strain S24733]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCTAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38