Detailed information NTG0552888

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: J7T96_RS08890
• Genome accession: NZ_CP072434
• Coordinates: 1702500..1702928 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24742
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1697500..1707928

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T96_RS08850 (J7T96_08705)	-	1697639..1698082 (-)	444	WP_084829882.1	CAAX protease	-
J7T96_RS08855	-	1698156..1698581 (-)	426	WP_087010196.1	CPBP family intramembrane glutamic endopeptidase	-
J7T96_RS08860 (J7T96_08715)	-	1698823..1699020 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
J7T96_RS08865 (J7T96_08720)	-	1699269..1700462 (-)	1194	WP_084831204.1	acetate kinase	-
J7T96_RS08870 (J7T96_08725)	comYH	1700518..1701474 (-)	957	WP_207559851.1	class I SAM-dependent methyltransferase	Machinery gene
J7T96_RS08875 (J7T96_08730)	comGG	1701519..1701836 (-)	318	WP_082309152.1	competence type IV pilus minor pilin ComGG	-
J7T96_RS08880 (J7T96_08735)	comYF	1701814..1702251 (-)	438	WP_082309153.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T96_RS08885 (J7T96_08740)	comGE	1702235..1702528 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
J7T96_RS08890 (J7T96_08745)	comYD	1702500..1702928 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T96_RS08895 (J7T96_08750)	comYC	1702888..1703214 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T96_RS08900 (J7T96_08755)	comYB	1703211..1704311 (-)	1101	WP_207559852.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7T96_RS08905 (J7T96_08760)	comGA/cglA/cilD	1704193..1705134 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T96_RS08910 (J7T96_08765)	-	1705215..1705577 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=552888 J7T96_RS08890 WP_011226626.1 1702500..1702928(-) (comYD) [Streptococcus thermophilus strain S24742]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=552888 J7T96_RS08890 WP_011226626.1 1702500..1702928(-) (comYD) [Streptococcus thermophilus strain S24742]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCTAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38