Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | J7U22_RS07520 | Genome accession | NZ_CP072428 |
| Coordinates | 1451482..1451691 (-) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain S24749 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1446482..1456691
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J7U22_RS07485 (J7U22_07460) | - | 1447481..1447792 (-) | 312 | WP_372588808.1 | urease subunit beta | - |
| J7U22_RS07490 (J7U22_07465) | - | 1447804..1448106 (-) | 303 | WP_002886558.1 | urease subunit gamma | - |
| J7U22_RS07495 (J7U22_07470) | - | 1448131..1448646 (-) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| J7U22_RS07500 | - | 1449051..1449947 (+) | 897 | WP_224102957.1 | urease cluster protein | - |
| J7U22_RS07505 | - | 1450187..1450471 (+) | 285 | WP_014727318.1 | hypothetical protein | - |
| J7U22_RS07510 (J7U22_07480) | - | 1450434..1450751 (-) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| J7U22_RS07515 (J7U22_07485) | - | 1450859..1451427 (-) | 569 | Protein_1456 | ATP-binding cassette domain-containing protein | - |
| J7U22_RS07520 | comA | 1451482..1451691 (-) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| J7U22_RS07525 (J7U22_07495) | comA | 1451713..1452003 (-) | 291 | WP_081004984.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| J7U22_RS07530 | comA | 1452034..1452444 (-) | 411 | WP_216593071.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| J7U22_RS07535 | - | 1452459..1452953 (-) | 495 | Protein_1460 | cysteine peptidase family C39 domain-containing protein | - |
| J7U22_RS07540 (J7U22_07510) | comR | 1453128..1454027 (-) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| J7U22_RS07545 (J7U22_07515) | - | 1454222..1454872 (-) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| J7U22_RS07550 (J7U22_07520) | - | 1454875..1455432 (-) | 558 | WP_002949523.1 | ECF transporter S component | - |
| J7U22_RS07555 (J7U22_07525) | - | 1455744..1456253 (-) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=552589 J7U22_RS07520 WP_002946147.1 1451482..1451691(-) (comA) [Streptococcus thermophilus strain S24749]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=552589 J7U22_RS07520 WP_002946147.1 1451482..1451691(-) (comA) [Streptococcus thermophilus strain S24749]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |