Detailed information NTG0547314

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: J3S98_RS11310
• Genome accession: NZ_CP071729
• Coordinates: 2251061..2251660 (+)
• Length: 199 a.a.
• NCBI ID: WP_011834647.1
• Uniprot ID: A0A166TF89
• Organism: Lactococcus cremoris strain FM-YL11
• Function: degradation of ComX (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2239099..2251660	2251061..2251660	within	0

Gene organization within MGE regions

Location: 2239099..2251660

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J3S98_RS11265 (J3S98_11265)	-	2241291..2242109 (-)	819	WP_228764453.1	polysaccharide deacetylase family protein	-
J3S98_RS11270 (J3S98_11270)	-	2242453..2243343 (-)	891	WP_207873725.1	IS982 family transposase	-
J3S98_RS11280 (J3S98_11280)	-	2244662..2245726 (-)	1065	Protein_2225	HAD-IC family P-type ATPase	-
J3S98_RS11285 (J3S98_11285)	istA	2246138..2247361 (+)	1224	WP_003331415.1	IS21-like element IS712 family transposase	-
J3S98_RS11290 (J3S98_11290)	istB	2247373..2248131 (+)	759	WP_003331414.1	IS21-like element IS712 family helper ATPase IstB	-
J3S98_RS11295 (J3S98_11295)	-	2248222..2249385 (+)	1164	WP_011675640.1	ABC transporter permease	-
J3S98_RS12710	-	2249482..2249616 (+)	135	WP_014572996.1	hypothetical protein	-
J3S98_RS11300 (J3S98_11300)	spx	2249767..2250165 (-)	399	WP_003129597.1	transcriptional regulator Spx	-
J3S98_RS11305 (J3S98_11305)	-	2250335..2250865 (-)	531	WP_011675638.1	hypothetical protein	-
J3S98_RS11310 (J3S98_11310)	clpP	2251061..2251660 (+)	600	WP_011834647.1	ATP-dependent Clp protease proteolytic subunit	Regulator

Sequence

Protein

• Length: 199 a.a.
• Molecular weight: 22052.21 Da
• Isoelectric Point: 4.7423

>NTDB_id=547314 J3S98_RS11310 WP_011834647.1 2251061..2251660(+) (clpP) [Lactococcus cremoris strain FM-YL11]
MGYLVPTVIEQSSRGERAYDIYSRLLKDRIIMLTGPVEDGMANSIIAQLLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVD
TMNFIKSDVQTIVMGMAASMGTIIASSGTKGKRFMLPNAEYLIHQPMGGAGQGTQQTDMAIVAEQLLKTRKRLEQILADN
SNRSLEQIHKDAERDHWMDAKETLEYGFIDEIMENNSLK

Nucleotide

• Length: 600 bp

>NTDB_id=547314 J3S98_RS11310 WP_011834647.1 2251061..2251660(+) (clpP) [Lactococcus cremoris strain FM-YL11]
ATGGGTTATTTAGTACCTACCGTTATTGAACAATCAAGCCGTGGTGAACGTGCTTATGATATTTATTCACGACTTTTAAA
AGACCGTATTATCATGCTGACAGGACCTGTTGAAGATGGTATGGCAAATTCTATCATTGCCCAACTTCTTTTCTTGGATG
CACAAGATAATACTAAAGACATTTATCTCTATGTAAACACCCCTGGTGGTTCTGTATCAGCTGGGCTCGCTATCGTGGAT
ACAATGAACTTTATCAAATCGGATGTCCAAACTATCGTTATGGGAATGGCTGCTTCTATGGGAACAATCATCGCCTCAAG
CGGTACTAAGGGTAAACGATTCATGTTACCAAATGCTGAATACCTCATTCACCAACCAATGGGTGGTGCAGGTCAAGGTA
CTCAACAAACTGATATGGCAATCGTCGCCGAACAACTTTTGAAAACACGTAAACGTTTGGAACAAATCCTTGCTGATAAT
TCTAATCGCTCACTTGAACAAATTCACAAAGATGCTGAACGTGACCATTGGATGGATGCCAAAGAAACTTTAGAATATGG
TTTCATTGATGAAATTATGGAAAATAATTCATTAAAATAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (14-195)

3D structure

• AlphaFold DB: A0A166TF89

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Lactococcus lactis subsp. cremoris KW2	100	100	1
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	99.497	100	0.995
clpP	Streptococcus mutans UA159	87.245	98.492	0.859
clpP	Streptococcus thermophilus LMD-9	86.735	98.492	0.854
clpP	Streptococcus thermophilus LMG 18311	86.735	98.492	0.854
clpP	Streptococcus pyogenes MGAS315	85.714	98.492	0.844
clpP	Streptococcus pyogenes JRS4	85.714	98.492	0.844
clpP	Streptococcus pneumoniae D39	84.615	97.99	0.829
clpP	Streptococcus pneumoniae TIGR4	84.615	97.99	0.829
clpP	Streptococcus pneumoniae R6	84.615	97.99	0.829
clpP	Streptococcus pneumoniae Rx1	84.615	97.99	0.829
clpP	Bacillus subtilis subsp. subtilis str. 168	57.895	95.477	0.553
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	56.995	96.985	0.553