Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI44_RS09055 | Genome accession | NZ_CP071148 |
| Coordinates | 1899458..1899643 (-) | Length | 61 a.a. |
| NCBI ID | WP_012679954.1 | Uniprot ID | C0M6G1 |
| Organism | Streptococcus equi subsp. equi strain 470_001 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1899458..1930240 | 1899458..1899643 | within | 0 |
Gene organization within MGE regions
Location: 1899458..1930240
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI44_RS09055 (JZI44_09055) | prx | 1899458..1899643 (-) | 186 | WP_012679954.1 | hypothetical protein | Regulator |
| JZI44_RS09060 (JZI44_09060) | spel | 1899765..1900553 (-) | 789 | WP_012679955.1 | streptococcal pyrogenic exotoxin SpeL | - |
| JZI44_RS09065 (JZI44_09065) | spek | 1900820..1901599 (-) | 780 | WP_050316071.1 | streptococcal pyrogenic exotoxin SpeK | - |
| JZI44_RS09070 (JZI44_09070) | - | 1901724..1902953 (-) | 1230 | WP_012679957.1 | glucosaminidase domain-containing protein | - |
| JZI44_RS09075 (JZI44_09075) | - | 1903065..1903244 (-) | 180 | WP_012679339.1 | holin | - |
| JZI44_RS09080 (JZI44_09080) | - | 1903247..1903537 (-) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI44_RS09085 (JZI44_09085) | - | 1903550..1904164 (-) | 615 | WP_012679958.1 | DUF1366 domain-containing protein | - |
| JZI44_RS09090 (JZI44_09090) | - | 1904167..1904598 (-) | 432 | WP_012679959.1 | DUF1617 family protein | - |
| JZI44_RS09095 (JZI44_09095) | - | 1904607..1906511 (-) | 1905 | WP_012679960.1 | gp58-like family protein | - |
| JZI44_RS09100 (JZI44_09100) | - | 1906522..1907136 (-) | 615 | WP_012679961.1 | hypothetical protein | - |
| JZI44_RS09105 (JZI44_09105) | - | 1907138..1907845 (-) | 708 | WP_012679962.1 | collagen-like protein | - |
| JZI44_RS09110 (JZI44_09110) | - | 1907845..1909902 (-) | 2058 | WP_050316055.1 | phage tail spike protein | - |
| JZI44_RS09115 (JZI44_09115) | - | 1909899..1910678 (-) | 780 | WP_012679964.1 | distal tail protein Dit | - |
| JZI44_RS09120 (JZI44_09120) | - | 1910710..1913964 (-) | 3255 | WP_012679965.1 | tape measure protein | - |
| JZI44_RS09125 (JZI44_09125) | - | 1913981..1914244 (-) | 264 | WP_230197369.1 | hypothetical protein | - |
| JZI44_RS09130 (JZI44_09130) | - | 1914352..1914711 (-) | 360 | WP_012679967.1 | tail assembly chaperone | - |
| JZI44_RS09135 (JZI44_09135) | - | 1914773..1915298 (-) | 526 | Protein_1787 | phage major tail protein, TP901-1 family | - |
| JZI44_RS09140 (JZI44_09140) | - | 1915374..1915763 (-) | 390 | WP_012679970.1 | hypothetical protein | - |
| JZI44_RS09145 (JZI44_09145) | - | 1915760..1916125 (-) | 366 | WP_012679971.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JZI44_RS09150 (JZI44_09150) | - | 1916106..1916414 (-) | 309 | WP_012679972.1 | hypothetical protein | - |
| JZI44_RS09155 (JZI44_09155) | - | 1916411..1916764 (-) | 354 | WP_012679973.1 | phage head-tail connector protein | - |
| JZI44_RS09160 (JZI44_09160) | - | 1916774..1917040 (-) | 267 | WP_012679974.1 | HeH/LEM domain-containing protein | - |
| JZI44_RS09165 (JZI44_09165) | - | 1917051..1918100 (-) | 1050 | WP_012679975.1 | major capsid protein | - |
| JZI44_RS09170 (JZI44_09170) | - | 1918103..1918483 (-) | 381 | WP_012679976.1 | head decoration protein | - |
| JZI44_RS09175 (JZI44_09175) | - | 1918494..1919117 (-) | 624 | WP_042357153.1 | DUF4355 domain-containing protein | - |
| JZI44_RS09180 (JZI44_09180) | - | 1919299..1919466 (-) | 168 | WP_012679978.1 | hypothetical protein | - |
| JZI44_RS09185 (JZI44_09185) | - | 1919502..1919771 (-) | 270 | WP_012679979.1 | hypothetical protein | - |
| JZI44_RS09190 (JZI44_09190) | - | 1919968..1920387 (-) | 420 | WP_012679981.1 | HD domain-containing protein | - |
| JZI44_RS09195 (JZI44_09195) | - | 1920384..1920590 (-) | 207 | WP_003052398.1 | hypothetical protein | - |
| JZI44_RS09200 (JZI44_09200) | - | 1920592..1922169 (-) | 1578 | WP_042357165.1 | phage head morphogenesis protein | - |
| JZI44_RS09205 (JZI44_09205) | - | 1922150..1923652 (-) | 1503 | WP_050316050.1 | phage portal protein | - |
| JZI44_RS09210 (JZI44_09210) | - | 1923664..1924911 (-) | 1248 | WP_012679984.1 | PBSX family phage terminase large subunit | - |
| JZI44_RS09220 (JZI44_09220) | - | 1926503..1927291 (+) | 789 | WP_012679985.1 | helix-turn-helix transcriptional regulator | - |
| JZI44_RS09225 (JZI44_09225) | - | 1927300..1928469 (+) | 1170 | WP_012679986.1 | DUF4041 domain-containing protein | - |
| JZI44_RS09230 (JZI44_09230) | - | 1928472..1928675 (+) | 204 | WP_012679987.1 | hypothetical protein | - |
| JZI44_RS09235 (JZI44_09235) | - | 1928807..1930240 (+) | 1434 | WP_012679988.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6981.00 Da Isoelectric Point: 3.8428
>NTDB_id=543252 JZI44_RS09055 WP_012679954.1 1899458..1899643(-) (prx) [Streptococcus equi subsp. equi strain 470_001]
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
Nucleotide
Download Length: 186 bp
>NTDB_id=543252 JZI44_RS09055 WP_012679954.1 1899458..1899643(-) (prx) [Streptococcus equi subsp. equi strain 470_001]
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
95.082 |
0.705 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS8232 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
95.082 |
0.639 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
68.852 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
67.213 |
0.557 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
67.213 |
0.475 |