Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI44_RS04875 | Genome accession | NZ_CP071148 |
| Coordinates | 981285..981467 (+) | Length | 60 a.a. |
| NCBI ID | WP_012679346.1 | Uniprot ID | C0MBQ2 |
| Organism | Streptococcus equi subsp. equi strain 470_001 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 926487..986016 | 981285..981467 | within | 0 |
Gene organization within MGE regions
Location: 926487..986016
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI44_RS04540 (JZI44_04540) | - | 926487..927335 (+) | 849 | WP_012515348.1 | glycoside hydrolase family 25 protein | - |
| JZI44_RS04545 (JZI44_04545) | thiT | 927887..928450 (+) | 564 | WP_012679277.1 | energy-coupled thiamine transporter ThiT | - |
| JZI44_RS04550 (JZI44_04550) | - | 928611..929090 (+) | 480 | WP_012679276.1 | aminoacyl-tRNA deacylase | - |
| JZI44_RS04555 (JZI44_04555) | - | 929087..929221 (+) | 135 | Protein_875 | YccF domain-containing protein | - |
| JZI44_RS04565 (JZI44_04565) | - | 930662..931252 (+) | 591 | WP_042356873.1 | ABC transporter ATP-binding protein | - |
| JZI44_RS04570 (JZI44_04570) | - | 931262..932824 (+) | 1563 | WP_042356875.1 | ABC transporter ATP-binding protein | - |
| JZI44_RS04575 (JZI44_04575) | prfB | 933207..934308 (+) | 1102 | WP_111692358.1 | peptide chain release factor 2 | - |
| JZI44_RS04580 (JZI44_04580) | ftsE | 934359..935051 (+) | 693 | WP_012678167.1 | cell division ATP-binding protein FtsE | - |
| JZI44_RS04585 (JZI44_04585) | ftsX | 935044..935973 (+) | 930 | WP_042357406.1 | permease-like cell division protein FtsX | - |
| JZI44_RS04590 (JZI44_04590) | - | 936363..937004 (-) | 642 | WP_012679287.1 | MBL fold metallo-hydrolase | - |
| JZI44_RS04595 (JZI44_04595) | - | 937341..939812 (+) | 2472 | WP_012679288.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| JZI44_RS04600 (JZI44_04600) | - | 939986..941152 (-) | 1167 | WP_012679289.1 | site-specific integrase | - |
| JZI44_RS11005 | - | 941330..941587 (-) | 258 | WP_012679290.1 | phage membrane protein | - |
| JZI44_RS04610 (JZI44_04610) | - | 941912..942316 (-) | 405 | WP_012679291.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JZI44_RS04615 (JZI44_04615) | - | 942330..942680 (-) | 351 | WP_012679292.1 | helix-turn-helix transcriptional regulator | - |
| JZI44_RS04625 (JZI44_04625) | - | 944538..944750 (+) | 213 | WP_012679293.1 | hypothetical protein | - |
| JZI44_RS04630 (JZI44_04630) | - | 944823..945074 (+) | 252 | WP_012679294.1 | hypothetical protein | - |
| JZI44_RS04635 (JZI44_04635) | - | 945350..945691 (+) | 342 | WP_012679297.1 | hypothetical protein | - |
| JZI44_RS04640 (JZI44_04640) | - | 945691..946173 (+) | 483 | WP_012679298.1 | siphovirus Gp157 family protein | - |
| JZI44_RS04645 (JZI44_04645) | - | 946170..946643 (+) | 474 | WP_012679299.1 | hypothetical protein | - |
| JZI44_RS04650 (JZI44_04650) | - | 946603..947778 (+) | 1176 | WP_050315853.1 | DEAD/DEAH box helicase family protein | - |
| JZI44_RS04655 (JZI44_04655) | - | 947788..948498 (+) | 711 | WP_012679301.1 | ERF family protein | - |
| JZI44_RS04660 (JZI44_04660) | ssbA | 948499..948891 (+) | 393 | WP_012679302.1 | single-stranded DNA-binding protein | Machinery gene |
| JZI44_RS04665 (JZI44_04665) | - | 948905..949732 (+) | 828 | WP_012679303.1 | bifunctional DNA primase/polymerase | - |
| JZI44_RS04670 (JZI44_04670) | - | 949716..951116 (+) | 1401 | WP_012679304.1 | virulence-associated E family protein | - |
| JZI44_RS04675 (JZI44_04675) | - | 951472..951666 (+) | 195 | WP_012679305.1 | hypothetical protein | - |
| JZI44_RS04680 (JZI44_04680) | - | 951659..951886 (+) | 228 | WP_012679306.1 | hypothetical protein | - |
| JZI44_RS04685 (JZI44_04685) | - | 951897..952586 (+) | 690 | WP_042356880.1 | site-specific DNA-methyltransferase | - |
| JZI44_RS04690 (JZI44_04690) | - | 952588..953379 (+) | 792 | WP_050315852.1 | DNA cytosine methyltransferase | - |
| JZI44_RS04695 (JZI44_04695) | - | 953363..953866 (+) | 504 | WP_050315851.1 | DNA cytosine methyltransferase | - |
| JZI44_RS04700 (JZI44_04700) | - | 953856..954374 (+) | 519 | WP_012679308.1 | DUF1642 domain-containing protein | - |
| JZI44_RS04705 (JZI44_04705) | - | 954401..954700 (+) | 300 | WP_042357412.1 | hypothetical protein | - |
| JZI44_RS04710 (JZI44_04710) | - | 954717..954890 (+) | 174 | WP_012679310.1 | hypothetical protein | - |
| JZI44_RS04715 (JZI44_04715) | - | 955227..955667 (+) | 441 | WP_012679312.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JZI44_RS04720 (JZI44_04720) | - | 956065..956442 (-) | 378 | WP_012679314.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| JZI44_RS04725 (JZI44_04725) | - | 956494..956679 (-) | 186 | WP_012679315.1 | type II toxin-antitoxin system HicA family toxin | - |
| JZI44_RS04730 (JZI44_04730) | - | 956795..957130 (+) | 336 | WP_012679316.1 | HNH endonuclease signature motif containing protein | - |
| JZI44_RS04735 (JZI44_04735) | - | 957293..957760 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| JZI44_RS04740 (JZI44_04740) | - | 957775..959529 (+) | 1755 | WP_012679317.1 | terminase TerL endonuclease subunit | - |
| JZI44_RS04745 (JZI44_04745) | - | 959526..959696 (+) | 171 | WP_012679318.1 | hypothetical protein | - |
| JZI44_RS04750 (JZI44_04750) | - | 959689..959955 (+) | 267 | WP_012679319.1 | hypothetical protein | - |
| JZI44_RS04755 (JZI44_04755) | - | 959989..961209 (+) | 1221 | WP_012679320.1 | phage portal protein | - |
| JZI44_RS04760 (JZI44_04760) | - | 961187..961852 (+) | 666 | WP_012679321.1 | head maturation protease, ClpP-related | - |
| JZI44_RS04765 (JZI44_04765) | - | 961877..963064 (+) | 1188 | WP_012679322.1 | phage major capsid protein | - |
| JZI44_RS11185 | - | 963078..963206 (+) | 129 | WP_012679323.1 | hypothetical protein | - |
| JZI44_RS04770 (JZI44_04770) | - | 963209..963511 (+) | 303 | WP_012679324.1 | head-tail connector protein | - |
| JZI44_RS04775 (JZI44_04775) | - | 963508..963855 (+) | 348 | WP_012679325.1 | phage head closure protein | - |
| JZI44_RS04780 (JZI44_04780) | - | 963852..964229 (+) | 378 | WP_012679326.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JZI44_RS04785 (JZI44_04785) | - | 964226..964651 (+) | 426 | WP_050315850.1 | hypothetical protein | - |
| JZI44_RS04790 (JZI44_04790) | - | 964667..965257 (+) | 591 | WP_012679328.1 | major tail protein | - |
| JZI44_RS04795 (JZI44_04795) | - | 965309..965635 (+) | 327 | WP_012679329.1 | hypothetical protein | - |
| JZI44_RS04800 (JZI44_04800) | - | 965683..965832 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| JZI44_RS04805 (JZI44_04805) | - | 965845..969504 (+) | 3660 | WP_050315849.1 | phage tail tape measure protein | - |
| JZI44_RS04810 (JZI44_04810) | - | 969504..970211 (+) | 708 | WP_012679331.1 | distal tail protein Dit | - |
| JZI44_RS04815 (JZI44_04815) | - | 970208..972349 (+) | 2142 | WP_012679332.1 | phage tail spike protein | - |
| JZI44_RS04820 (JZI44_04820) | - | 972349..973110 (+) | 762 | WP_012679333.1 | collagen-like protein | - |
| JZI44_RS04825 (JZI44_04825) | - | 973112..973729 (+) | 618 | WP_012679334.1 | hypothetical protein | - |
| JZI44_RS04830 (JZI44_04830) | - | 973740..975623 (+) | 1884 | WP_012679335.1 | gp58-like family protein | - |
| JZI44_RS04835 (JZI44_04835) | - | 975632..976063 (+) | 432 | WP_012679336.1 | DUF1617 family protein | - |
| JZI44_RS04840 (JZI44_04840) | - | 976066..976680 (+) | 615 | WP_012679337.1 | DUF1366 domain-containing protein | - |
| JZI44_RS04845 (JZI44_04845) | - | 976693..976983 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI44_RS04850 (JZI44_04850) | - | 976986..977165 (+) | 180 | WP_012679339.1 | holin | - |
| JZI44_RS04855 (JZI44_04855) | - | 977277..978473 (+) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| JZI44_RS04860 (JZI44_04860) | - | 978608..979150 (+) | 543 | WP_012679342.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| JZI44_RS04865 (JZI44_04865) | - | 979154..979990 (+) | 837 | WP_012679343.1 | hypothetical protein | - |
| JZI44_RS04870 (JZI44_04870) | - | 980362..980937 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| JZI44_RS11010 | - | 980931..981218 (+) | 288 | WP_011106694.1 | hypothetical protein | - |
| JZI44_RS04875 (JZI44_04875) | prx | 981285..981467 (+) | 183 | WP_012679346.1 | hypothetical protein | Regulator |
| JZI44_RS04880 (JZI44_04880) | - | 981659..982054 (+) | 396 | WP_228275436.1 | DUF5590 domain-containing protein | - |
| JZI44_RS04885 (JZI44_04885) | - | 982051..983262 (+) | 1212 | WP_012679347.1 | pyridoxal phosphate-dependent aminotransferase | - |
| JZI44_RS04890 (JZI44_04890) | asnS | 983275..984621 (+) | 1347 | WP_012679348.1 | asparagine--tRNA ligase | - |
| JZI44_RS04895 (JZI44_04895) | - | 984922..986016 (+) | 1095 | WP_012679349.1 | LPXTG cell wall anchor domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6943.77 Da Isoelectric Point: 4.1677
>NTDB_id=543234 JZI44_RS04875 WP_012679346.1 981285..981467(+) (prx) [Streptococcus equi subsp. equi strain 470_001]
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVRNGEVVTDEKVEEVMRELDK
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVRNGEVVTDEKVEEVMRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=543234 JZI44_RS04875 WP_012679346.1 981285..981467(+) (prx) [Streptococcus equi subsp. equi strain 470_001]
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTAAGGAACGGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTAAGGAACGGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |