Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI44_RS03305 | Genome accession | NZ_CP071148 |
| Coordinates | 645596..645775 (+) | Length | 59 a.a. |
| NCBI ID | WP_002983481.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. equi strain 470_001 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 606601..652399 | 645596..645775 | within | 0 |
Gene organization within MGE regions
Location: 606601..652399
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI44_RS03030 (JZI44_03030) | - | 606601..607680 (-) | 1080 | WP_050315898.1 | tyrosine-type recombinase/integrase | - |
| JZI44_RS03035 (JZI44_03035) | - | 607801..608076 (-) | 276 | WP_050315897.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JZI44_RS03040 (JZI44_03040) | - | 608066..608284 (-) | 219 | WP_050315896.1 | DUF6290 family protein | - |
| JZI44_RS03045 (JZI44_03045) | - | 608300..609028 (-) | 729 | WP_231191385.1 | helix-turn-helix transcriptional regulator | - |
| JZI44_RS03050 (JZI44_03050) | - | 609212..609418 (+) | 207 | WP_050315895.1 | helix-turn-helix transcriptional regulator | - |
| JZI44_RS03055 (JZI44_03055) | - | 609468..609623 (+) | 156 | WP_154235342.1 | hypothetical protein | - |
| JZI44_RS03060 (JZI44_03060) | - | 609624..609827 (-) | 204 | WP_050315894.1 | hypothetical protein | - |
| JZI44_RS03065 (JZI44_03065) | - | 609947..610231 (+) | 285 | WP_050315893.1 | hypothetical protein | - |
| JZI44_RS03070 (JZI44_03070) | - | 610228..610374 (+) | 147 | WP_173476788.1 | hypothetical protein | - |
| JZI44_RS03075 (JZI44_03075) | - | 610355..610531 (+) | 177 | WP_154235341.1 | hypothetical protein | - |
| JZI44_RS03080 (JZI44_03080) | - | 610533..610775 (+) | 243 | WP_050315892.1 | hypothetical protein | - |
| JZI44_RS03085 (JZI44_03085) | - | 610759..612078 (+) | 1320 | WP_050315891.1 | AAA family ATPase | - |
| JZI44_RS03090 (JZI44_03090) | - | 612094..613173 (+) | 1080 | WP_050315890.1 | ATP-binding protein | - |
| JZI44_RS03095 (JZI44_03095) | - | 613213..613635 (+) | 423 | WP_050315889.1 | hypothetical protein | - |
| JZI44_RS03100 (JZI44_03100) | - | 613637..614371 (+) | 735 | WP_050315888.1 | hypothetical protein | - |
| JZI44_RS03105 (JZI44_03105) | - | 614393..614977 (+) | 585 | WP_050315887.1 | hypothetical protein | - |
| JZI44_RS03110 (JZI44_03110) | - | 614977..616560 (+) | 1584 | WP_050315886.1 | DEAD/DEAH box helicase | - |
| JZI44_RS03115 (JZI44_03115) | - | 616569..618842 (+) | 2274 | WP_050315885.1 | AAA family ATPase | - |
| JZI44_RS03120 (JZI44_03120) | - | 619120..619338 (+) | 219 | WP_050315884.1 | hypothetical protein | - |
| JZI44_RS03125 (JZI44_03125) | - | 619331..619726 (+) | 396 | WP_050315883.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JZI44_RS03130 (JZI44_03130) | - | 619723..619947 (+) | 225 | WP_050315882.1 | hypothetical protein | - |
| JZI44_RS10975 | - | 619950..620135 (+) | 186 | WP_050315881.1 | hypothetical protein | - |
| JZI44_RS03135 (JZI44_03135) | - | 620203..620643 (+) | 441 | WP_050315880.1 | YopX family protein | - |
| JZI44_RS03140 (JZI44_03140) | - | 620640..620846 (+) | 207 | WP_050315879.1 | hypothetical protein | - |
| JZI44_RS03145 (JZI44_03145) | - | 620857..621084 (+) | 228 | WP_050315878.1 | hypothetical protein | - |
| JZI44_RS03150 (JZI44_03150) | - | 621089..621838 (+) | 750 | WP_050315877.1 | site-specific DNA-methyltransferase | - |
| JZI44_RS03155 (JZI44_03155) | - | 621852..622055 (+) | 204 | WP_050315876.1 | hypothetical protein | - |
| JZI44_RS03160 (JZI44_03160) | - | 622167..622601 (+) | 435 | WP_050315875.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JZI44_RS03165 (JZI44_03165) | - | 622854..623297 (+) | 444 | WP_251004689.1 | terminase small subunit | - |
| JZI44_RS03170 (JZI44_03170) | - | 623287..624585 (+) | 1299 | WP_050315874.1 | PBSX family phage terminase large subunit | - |
| JZI44_RS03175 (JZI44_03175) | - | 624595..626094 (+) | 1500 | WP_050315873.1 | phage portal protein | - |
| JZI44_RS03180 (JZI44_03180) | - | 626094..627704 (+) | 1611 | WP_050315872.1 | phage minor capsid protein | - |
| JZI44_RS03185 (JZI44_03185) | - | 627670..627891 (+) | 222 | WP_050315871.1 | CPCC family cysteine-rich protein | - |
| JZI44_RS03190 (JZI44_03190) | - | 627943..628227 (+) | 285 | WP_050315870.1 | hypothetical protein | - |
| JZI44_RS03195 (JZI44_03195) | - | 628313..628552 (+) | 240 | WP_050315869.1 | hypothetical protein | - |
| JZI44_RS03200 (JZI44_03200) | - | 628537..629139 (+) | 603 | WP_050315868.1 | hypothetical protein | - |
| JZI44_RS03205 (JZI44_03205) | - | 629141..630013 (+) | 873 | WP_050315867.1 | hypothetical protein | - |
| JZI44_RS03210 (JZI44_03210) | - | 630024..630272 (+) | 249 | WP_050315866.1 | hypothetical protein | - |
| JZI44_RS03215 (JZI44_03215) | - | 630275..630661 (+) | 387 | WP_050315865.1 | hypothetical protein | - |
| JZI44_RS03220 (JZI44_03220) | - | 630655..630999 (+) | 345 | WP_050315864.1 | putative minor capsid protein | - |
| JZI44_RS03225 (JZI44_03225) | - | 630996..631349 (+) | 354 | WP_050315863.1 | minor capsid protein | - |
| JZI44_RS03230 (JZI44_03230) | - | 631352..631720 (+) | 369 | WP_050315862.1 | hypothetical protein | - |
| JZI44_RS03235 (JZI44_03235) | - | 631724..632221 (+) | 498 | WP_050315861.1 | hypothetical protein | - |
| JZI44_RS03240 (JZI44_03240) | - | 632241..632648 (+) | 408 | WP_050315860.1 | hypothetical protein | - |
| JZI44_RS03245 (JZI44_03245) | - | 632656..633273 (+) | 618 | WP_050315859.1 | Gp15 family bacteriophage protein | - |
| JZI44_RS03250 (JZI44_03250) | - | 633274..635721 (+) | 2448 | WP_050315858.1 | phage tail tape measure protein | - |
| JZI44_RS03255 (JZI44_03255) | - | 635725..636486 (+) | 762 | WP_050315857.1 | phage tail domain-containing protein | - |
| JZI44_RS03260 (JZI44_03260) | - | 636497..638491 (+) | 1995 | WP_050315856.1 | phage tail protein | - |
| JZI44_RS03265 (JZI44_03265) | - | 638488..639603 (+) | 1116 | WP_050315855.1 | hyaluronoglucosaminidase | - |
| JZI44_RS03270 (JZI44_03270) | - | 639622..641655 (+) | 2034 | WP_050316809.1 | gp58-like family protein | - |
| JZI44_RS03275 (JZI44_03275) | - | 641664..642095 (+) | 432 | WP_050316074.1 | DUF1617 family protein | - |
| JZI44_RS03280 (JZI44_03280) | - | 642098..642715 (+) | 618 | WP_050316075.1 | DUF1366 domain-containing protein | - |
| JZI44_RS03285 (JZI44_03285) | - | 642728..643018 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI44_RS03290 (JZI44_03290) | - | 643021..643200 (+) | 180 | WP_012679339.1 | holin | - |
| JZI44_RS03295 (JZI44_03295) | - | 643312..644508 (+) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| JZI44_RS03300 (JZI44_03300) | - | 644735..645529 (+) | 795 | WP_050315918.1 | DNA/RNA non-specific endonuclease | - |
| JZI44_RS03305 (JZI44_03305) | prx | 645596..645775 (+) | 180 | WP_002983481.1 | hypothetical protein | Regulator |
| JZI44_RS03310 (JZI44_03310) | rimP | 647156..647638 (+) | 483 | WP_042356782.1 | ribosome maturation factor RimP | - |
| JZI44_RS03315 (JZI44_03315) | nusA | 647748..648902 (+) | 1155 | WP_012515088.1 | transcription termination factor NusA | - |
| JZI44_RS03320 (JZI44_03320) | - | 648918..649214 (+) | 297 | WP_012679099.1 | YlxR family protein | - |
| JZI44_RS03325 (JZI44_03325) | - | 649207..649509 (+) | 303 | WP_012678425.1 | YlxQ-related RNA-binding protein | - |
| JZI44_RS03330 (JZI44_03330) | infB | 649529..652399 (+) | 2871 | WP_012679100.1 | translation initiation factor IF-2 | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.1813
>NTDB_id=543227 JZI44_RS03305 WP_002983481.1 645596..645775(+) (prx) [Streptococcus equi subsp. equi strain 470_001]
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=543227 JZI44_RS03305 WP_002983481.1 645596..645775(+) (prx) [Streptococcus equi subsp. equi strain 470_001]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
71.186 |
100 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
71.186 |
0.542 |