Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI48_RS07505 | Genome accession | NZ_CP071145 |
| Coordinates | 1532357..1532542 (+) | Length | 61 a.a. |
| NCBI ID | WP_012679954.1 | Uniprot ID | C0M6G1 |
| Organism | Streptococcus equi subsp. equi strain 470_007 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1501760..1532542 | 1532357..1532542 | within | 0 |
Gene organization within MGE regions
Location: 1501760..1532542
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI48_RS07325 (JZI48_07325) | - | 1501760..1503193 (-) | 1434 | WP_012679988.1 | recombinase family protein | - |
| JZI48_RS07330 (JZI48_07330) | - | 1503325..1503528 (-) | 204 | WP_012679987.1 | hypothetical protein | - |
| JZI48_RS07335 (JZI48_07335) | - | 1503531..1504700 (-) | 1170 | WP_012679986.1 | DUF4041 domain-containing protein | - |
| JZI48_RS07340 (JZI48_07340) | - | 1504709..1505497 (-) | 789 | WP_012679985.1 | helix-turn-helix transcriptional regulator | - |
| JZI48_RS07345 (JZI48_07345) | - | 1505729..1507071 (+) | 1343 | WP_165626751.1 | IS3 family transposase | - |
| JZI48_RS07350 (JZI48_07350) | - | 1507089..1508336 (+) | 1248 | WP_012679984.1 | PBSX family phage terminase large subunit | - |
| JZI48_RS07355 (JZI48_07355) | - | 1508348..1509850 (+) | 1503 | WP_050316050.1 | phage portal protein | - |
| JZI48_RS07360 (JZI48_07360) | - | 1509831..1511408 (+) | 1578 | WP_042357165.1 | phage head morphogenesis protein | - |
| JZI48_RS07365 (JZI48_07365) | - | 1511410..1511616 (+) | 207 | WP_003052398.1 | hypothetical protein | - |
| JZI48_RS07370 (JZI48_07370) | - | 1511613..1512032 (+) | 420 | WP_012679981.1 | HD domain-containing protein | - |
| JZI48_RS07375 (JZI48_07375) | - | 1512229..1512498 (+) | 270 | WP_012679979.1 | hypothetical protein | - |
| JZI48_RS07380 (JZI48_07380) | - | 1512534..1512701 (+) | 168 | WP_012679978.1 | hypothetical protein | - |
| JZI48_RS07385 (JZI48_07385) | - | 1512883..1513506 (+) | 624 | WP_042357153.1 | DUF4355 domain-containing protein | - |
| JZI48_RS07390 (JZI48_07390) | - | 1513517..1513897 (+) | 381 | WP_012679976.1 | head decoration protein | - |
| JZI48_RS07395 (JZI48_07395) | - | 1513900..1514949 (+) | 1050 | WP_012679975.1 | major capsid protein | - |
| JZI48_RS07400 (JZI48_07400) | - | 1514960..1515226 (+) | 267 | WP_012679974.1 | HeH/LEM domain-containing protein | - |
| JZI48_RS07405 (JZI48_07405) | - | 1515236..1515589 (+) | 354 | WP_012679973.1 | phage head-tail connector protein | - |
| JZI48_RS07410 (JZI48_07410) | - | 1515586..1515894 (+) | 309 | WP_012679972.1 | hypothetical protein | - |
| JZI48_RS07415 (JZI48_07415) | - | 1515875..1516240 (+) | 366 | WP_012679971.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JZI48_RS07420 (JZI48_07420) | - | 1516237..1516626 (+) | 390 | WP_012679970.1 | hypothetical protein | - |
| JZI48_RS07425 (JZI48_07425) | - | 1516702..1517227 (+) | 526 | Protein_1422 | phage major tail protein, TP901-1 family | - |
| JZI48_RS07430 (JZI48_07430) | - | 1517289..1517648 (+) | 360 | WP_012679967.1 | tail assembly chaperone | - |
| JZI48_RS07435 (JZI48_07435) | - | 1517756..1518019 (+) | 264 | WP_230197369.1 | hypothetical protein | - |
| JZI48_RS07440 (JZI48_07440) | - | 1518036..1521290 (+) | 3255 | WP_012679965.1 | tape measure protein | - |
| JZI48_RS07445 (JZI48_07445) | - | 1521322..1522101 (+) | 780 | WP_012679964.1 | distal tail protein Dit | - |
| JZI48_RS07450 (JZI48_07450) | - | 1522098..1524155 (+) | 2058 | WP_050316055.1 | phage tail spike protein | - |
| JZI48_RS07455 (JZI48_07455) | - | 1524155..1524862 (+) | 708 | WP_012679962.1 | collagen-like protein | - |
| JZI48_RS07460 (JZI48_07460) | - | 1524864..1525478 (+) | 615 | WP_012679961.1 | hypothetical protein | - |
| JZI48_RS07465 (JZI48_07465) | - | 1525489..1527393 (+) | 1905 | WP_012679960.1 | gp58-like family protein | - |
| JZI48_RS07470 (JZI48_07470) | - | 1527402..1527833 (+) | 432 | WP_012679959.1 | DUF1617 family protein | - |
| JZI48_RS07475 (JZI48_07475) | - | 1527836..1528450 (+) | 615 | WP_012679958.1 | DUF1366 domain-containing protein | - |
| JZI48_RS07480 (JZI48_07480) | - | 1528463..1528753 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI48_RS07485 (JZI48_07485) | - | 1528756..1528935 (+) | 180 | WP_012679339.1 | holin | - |
| JZI48_RS07490 (JZI48_07490) | - | 1529047..1530276 (+) | 1230 | WP_012679957.1 | glucosaminidase domain-containing protein | - |
| JZI48_RS07495 (JZI48_07495) | spek | 1530401..1531180 (+) | 780 | WP_050316071.1 | streptococcal pyrogenic exotoxin SpeK | - |
| JZI48_RS07500 (JZI48_07500) | spel | 1531447..1532235 (+) | 789 | WP_012679955.1 | streptococcal pyrogenic exotoxin SpeL | - |
| JZI48_RS07505 (JZI48_07505) | prx | 1532357..1532542 (+) | 186 | WP_012679954.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6981.00 Da Isoelectric Point: 3.8428
>NTDB_id=543191 JZI48_RS07505 WP_012679954.1 1532357..1532542(+) (prx) [Streptococcus equi subsp. equi strain 470_007]
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
Nucleotide
Download Length: 186 bp
>NTDB_id=543191 JZI48_RS07505 WP_012679954.1 1532357..1532542(+) (prx) [Streptococcus equi subsp. equi strain 470_007]
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
95.082 |
0.705 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS8232 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
95.082 |
0.639 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
68.852 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
67.213 |
0.557 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
67.213 |
0.475 |