Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI48_RS02450 | Genome accession | NZ_CP071145 |
| Coordinates | 533262..533441 (-) | Length | 59 a.a. |
| NCBI ID | WP_002983481.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. equi strain 470_007 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 532632..572436 | 533262..533441 | within | 0 |
Gene organization within MGE regions
Location: 532632..572436
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI48_RS02450 (JZI48_02450) | prx | 533262..533441 (-) | 180 | WP_002983481.1 | hypothetical protein | Regulator |
| JZI48_RS02455 (JZI48_02455) | - | 533508..534302 (-) | 795 | WP_050315918.1 | DNA/RNA non-specific endonuclease | - |
| JZI48_RS02460 (JZI48_02460) | - | 534529..535725 (-) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| JZI48_RS02465 (JZI48_02465) | - | 535837..536016 (-) | 180 | WP_012679339.1 | holin | - |
| JZI48_RS02470 (JZI48_02470) | - | 536019..536309 (-) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI48_RS02475 (JZI48_02475) | - | 536322..536939 (-) | 618 | WP_050316075.1 | DUF1366 domain-containing protein | - |
| JZI48_RS02480 (JZI48_02480) | - | 536942..537373 (-) | 432 | WP_050316074.1 | DUF1617 family protein | - |
| JZI48_RS02485 (JZI48_02485) | - | 537382..539415 (-) | 2034 | WP_050316809.1 | gp58-like family protein | - |
| JZI48_RS02490 (JZI48_02490) | - | 539434..540549 (-) | 1116 | WP_050315855.1 | hyaluronoglucosaminidase | - |
| JZI48_RS02495 (JZI48_02495) | - | 540546..542540 (-) | 1995 | WP_050315856.1 | phage tail protein | - |
| JZI48_RS02500 (JZI48_02500) | - | 542551..543312 (-) | 762 | WP_050315857.1 | phage tail domain-containing protein | - |
| JZI48_RS02505 (JZI48_02505) | - | 543316..545763 (-) | 2448 | WP_050315858.1 | phage tail tape measure protein | - |
| JZI48_RS02510 (JZI48_02510) | - | 545764..546381 (-) | 618 | WP_050315859.1 | Gp15 family bacteriophage protein | - |
| JZI48_RS02515 (JZI48_02515) | - | 546389..546796 (-) | 408 | WP_050315860.1 | hypothetical protein | - |
| JZI48_RS02520 (JZI48_02520) | - | 546816..547313 (-) | 498 | WP_050315861.1 | hypothetical protein | - |
| JZI48_RS02525 (JZI48_02525) | - | 547317..547685 (-) | 369 | WP_050315862.1 | hypothetical protein | - |
| JZI48_RS02530 (JZI48_02530) | - | 547688..548041 (-) | 354 | WP_050315863.1 | minor capsid protein | - |
| JZI48_RS02535 (JZI48_02535) | - | 548038..548382 (-) | 345 | WP_050315864.1 | putative minor capsid protein | - |
| JZI48_RS02540 (JZI48_02540) | - | 548376..548762 (-) | 387 | WP_050315865.1 | hypothetical protein | - |
| JZI48_RS02545 (JZI48_02545) | - | 548765..549013 (-) | 249 | WP_050315866.1 | hypothetical protein | - |
| JZI48_RS02550 (JZI48_02550) | - | 549024..549896 (-) | 873 | WP_050315867.1 | hypothetical protein | - |
| JZI48_RS02555 (JZI48_02555) | - | 549898..550500 (-) | 603 | WP_050315868.1 | hypothetical protein | - |
| JZI48_RS02560 (JZI48_02560) | - | 550485..550724 (-) | 240 | WP_050315869.1 | hypothetical protein | - |
| JZI48_RS02565 (JZI48_02565) | - | 550810..551094 (-) | 285 | WP_050315870.1 | hypothetical protein | - |
| JZI48_RS02570 (JZI48_02570) | - | 551146..551367 (-) | 222 | WP_050315871.1 | CPCC family cysteine-rich protein | - |
| JZI48_RS02575 (JZI48_02575) | - | 551333..552943 (-) | 1611 | WP_050315872.1 | phage minor capsid protein | - |
| JZI48_RS02580 (JZI48_02580) | - | 552943..554442 (-) | 1500 | WP_050315873.1 | phage portal protein | - |
| JZI48_RS02585 (JZI48_02585) | - | 554452..555750 (-) | 1299 | WP_050315874.1 | PBSX family phage terminase large subunit | - |
| JZI48_RS02590 (JZI48_02590) | - | 555740..556231 (-) | 492 | WP_349627896.1 | terminase small subunit | - |
| JZI48_RS02595 (JZI48_02595) | - | 556436..556870 (-) | 435 | WP_050315875.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JZI48_RS02600 (JZI48_02600) | - | 556982..557185 (-) | 204 | WP_050315876.1 | hypothetical protein | - |
| JZI48_RS02605 (JZI48_02605) | - | 557199..557948 (-) | 750 | WP_050315877.1 | site-specific DNA-methyltransferase | - |
| JZI48_RS02610 (JZI48_02610) | - | 557953..558180 (-) | 228 | WP_050315878.1 | hypothetical protein | - |
| JZI48_RS02615 (JZI48_02615) | - | 558191..558397 (-) | 207 | WP_050315879.1 | hypothetical protein | - |
| JZI48_RS02620 (JZI48_02620) | - | 558394..558834 (-) | 441 | WP_050315880.1 | YopX family protein | - |
| JZI48_RS10940 | - | 558902..559087 (-) | 186 | WP_050315881.1 | hypothetical protein | - |
| JZI48_RS02625 (JZI48_02625) | - | 559090..559314 (-) | 225 | WP_050315882.1 | hypothetical protein | - |
| JZI48_RS02630 (JZI48_02630) | - | 559311..559706 (-) | 396 | WP_050315883.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JZI48_RS02635 (JZI48_02635) | - | 559699..559917 (-) | 219 | WP_050315884.1 | hypothetical protein | - |
| JZI48_RS02640 (JZI48_02640) | - | 560195..562468 (-) | 2274 | WP_050315885.1 | AAA family ATPase | - |
| JZI48_RS02645 (JZI48_02645) | - | 562477..564060 (-) | 1584 | WP_050315886.1 | DEAD/DEAH box helicase | - |
| JZI48_RS02650 (JZI48_02650) | - | 564060..564644 (-) | 585 | WP_050315887.1 | hypothetical protein | - |
| JZI48_RS02655 (JZI48_02655) | - | 564666..565400 (-) | 735 | WP_050315888.1 | hypothetical protein | - |
| JZI48_RS02660 (JZI48_02660) | - | 565402..565824 (-) | 423 | WP_050315889.1 | hypothetical protein | - |
| JZI48_RS02665 (JZI48_02665) | - | 565864..566943 (-) | 1080 | WP_050315890.1 | ATP-binding protein | - |
| JZI48_RS02670 (JZI48_02670) | - | 566959..568278 (-) | 1320 | WP_050315891.1 | AAA family ATPase | - |
| JZI48_RS02675 (JZI48_02675) | - | 568262..568504 (-) | 243 | WP_050315892.1 | hypothetical protein | - |
| JZI48_RS02680 (JZI48_02680) | - | 568506..568682 (-) | 177 | WP_154235341.1 | hypothetical protein | - |
| JZI48_RS02685 (JZI48_02685) | - | 568663..568809 (-) | 147 | WP_173476788.1 | hypothetical protein | - |
| JZI48_RS02690 (JZI48_02690) | - | 568806..569090 (-) | 285 | WP_050315893.1 | hypothetical protein | - |
| JZI48_RS02695 (JZI48_02695) | - | 569210..569413 (+) | 204 | WP_050315894.1 | hypothetical protein | - |
| JZI48_RS02700 (JZI48_02700) | - | 569414..569569 (-) | 156 | WP_154235342.1 | hypothetical protein | - |
| JZI48_RS02705 (JZI48_02705) | - | 569619..569825 (-) | 207 | WP_050315895.1 | helix-turn-helix transcriptional regulator | - |
| JZI48_RS02710 (JZI48_02710) | - | 570009..570737 (+) | 729 | WP_231191385.1 | helix-turn-helix transcriptional regulator | - |
| JZI48_RS02715 (JZI48_02715) | - | 570753..570971 (+) | 219 | WP_050315896.1 | DUF6290 family protein | - |
| JZI48_RS02720 (JZI48_02720) | - | 570961..571236 (+) | 276 | WP_050315897.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JZI48_RS02725 (JZI48_02725) | - | 571357..572436 (+) | 1080 | WP_050315898.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.1813
>NTDB_id=543155 JZI48_RS02450 WP_002983481.1 533262..533441(-) (prx) [Streptococcus equi subsp. equi strain 470_007]
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDRGYIVEDTVTIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=543155 JZI48_RS02450 WP_002983481.1 533262..533441(-) (prx) [Streptococcus equi subsp. equi strain 470_007]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCGTAGAAGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTAGAAGAAG
TGCTGATGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS8232 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
71.186 |
100 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
71.186 |
0.542 |