Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI59_RS10005 | Genome accession | NZ_CP071144 |
| Coordinates | 2067277..2067459 (+) | Length | 60 a.a. |
| NCBI ID | WP_012679346.1 | Uniprot ID | C0MBQ2 |
| Organism | Streptococcus equi subsp. equi strain 470_008 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2010354..2072009 | 2067277..2067459 | within | 0 |
Gene organization within MGE regions
Location: 2010354..2072009
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI59_RS09655 (JZI59_09655) | - | 2010354..2010638 (+) | 285 | WP_173476790.1 | hypothetical protein | - |
| JZI59_RS11110 | - | 2010663..2011547 (+) | 885 | WP_250880204.1 | MFS transporter | - |
| JZI59_RS09665 (JZI59_09665) | - | 2011746..2012261 (-) | 516 | WP_012679278.1 | hypothetical protein | - |
| JZI59_RS09670 (JZI59_09670) | - | 2012478..2013326 (+) | 849 | WP_012515348.1 | glycoside hydrolase family 25 protein | - |
| JZI59_RS09675 (JZI59_09675) | thiT | 2013878..2014441 (+) | 564 | WP_012679277.1 | energy-coupled thiamine transporter ThiT | - |
| JZI59_RS09680 (JZI59_09680) | - | 2014602..2015081 (+) | 480 | WP_012679276.1 | aminoacyl-tRNA deacylase | - |
| JZI59_RS09685 (JZI59_09685) | - | 2015078..2015212 (+) | 135 | Protein_1866 | YccF domain-containing protein | - |
| JZI59_RS09695 (JZI59_09695) | - | 2016653..2017243 (+) | 591 | WP_042356873.1 | ABC transporter ATP-binding protein | - |
| JZI59_RS09700 (JZI59_09700) | - | 2017253..2018815 (+) | 1563 | WP_042356875.1 | ABC transporter ATP-binding protein | - |
| JZI59_RS09705 (JZI59_09705) | prfB | 2019198..2020299 (+) | 1102 | WP_111692358.1 | peptide chain release factor 2 | - |
| JZI59_RS09710 (JZI59_09710) | ftsE | 2020350..2021042 (+) | 693 | WP_012678167.1 | cell division ATP-binding protein FtsE | - |
| JZI59_RS09715 (JZI59_09715) | ftsX | 2021035..2021964 (+) | 930 | WP_042357406.1 | permease-like cell division protein FtsX | - |
| JZI59_RS09720 (JZI59_09720) | - | 2022354..2022995 (-) | 642 | WP_012679287.1 | MBL fold metallo-hydrolase | - |
| JZI59_RS09725 (JZI59_09725) | - | 2023332..2025803 (+) | 2472 | WP_012679288.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| JZI59_RS09730 (JZI59_09730) | - | 2025977..2027143 (-) | 1167 | WP_012679289.1 | site-specific integrase | - |
| JZI59_RS11115 | - | 2027321..2027578 (-) | 258 | WP_012679290.1 | phage membrane protein | - |
| JZI59_RS09740 (JZI59_09740) | - | 2027903..2028307 (-) | 405 | WP_012679291.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JZI59_RS09745 (JZI59_09745) | - | 2028321..2028671 (-) | 351 | WP_012679292.1 | helix-turn-helix transcriptional regulator | - |
| JZI59_RS09755 (JZI59_09755) | - | 2030529..2030741 (+) | 213 | WP_012679293.1 | hypothetical protein | - |
| JZI59_RS09760 (JZI59_09760) | - | 2030814..2031065 (+) | 252 | WP_012679294.1 | hypothetical protein | - |
| JZI59_RS09765 (JZI59_09765) | - | 2031341..2031682 (+) | 342 | WP_012679297.1 | hypothetical protein | - |
| JZI59_RS09770 (JZI59_09770) | - | 2031682..2032164 (+) | 483 | WP_012679298.1 | siphovirus Gp157 family protein | - |
| JZI59_RS09775 (JZI59_09775) | - | 2032161..2032634 (+) | 474 | WP_012679299.1 | hypothetical protein | - |
| JZI59_RS09780 (JZI59_09780) | - | 2032594..2033769 (+) | 1176 | WP_050315853.1 | DEAD/DEAH box helicase family protein | - |
| JZI59_RS09785 (JZI59_09785) | - | 2033779..2034489 (+) | 711 | WP_012679301.1 | ERF family protein | - |
| JZI59_RS09790 (JZI59_09790) | ssbA | 2034490..2034882 (+) | 393 | WP_012679302.1 | single-stranded DNA-binding protein | Machinery gene |
| JZI59_RS09795 (JZI59_09795) | - | 2034896..2035723 (+) | 828 | WP_012679303.1 | bifunctional DNA primase/polymerase | - |
| JZI59_RS09800 (JZI59_09800) | - | 2035707..2037107 (+) | 1401 | WP_012679304.1 | virulence-associated E family protein | - |
| JZI59_RS09805 (JZI59_09805) | - | 2037463..2037657 (+) | 195 | WP_012679305.1 | hypothetical protein | - |
| JZI59_RS09810 (JZI59_09810) | - | 2037650..2037877 (+) | 228 | WP_012679306.1 | hypothetical protein | - |
| JZI59_RS09815 (JZI59_09815) | - | 2037888..2038577 (+) | 690 | WP_042356880.1 | site-specific DNA-methyltransferase | - |
| JZI59_RS09820 (JZI59_09820) | - | 2038579..2039370 (+) | 792 | WP_050315852.1 | DNA cytosine methyltransferase | - |
| JZI59_RS09825 (JZI59_09825) | - | 2039354..2039857 (+) | 504 | WP_050315851.1 | DNA cytosine methyltransferase | - |
| JZI59_RS09830 (JZI59_09830) | - | 2039847..2040365 (+) | 519 | WP_012679308.1 | DUF1642 domain-containing protein | - |
| JZI59_RS09835 (JZI59_09835) | - | 2040392..2040691 (+) | 300 | WP_042357412.1 | hypothetical protein | - |
| JZI59_RS09840 (JZI59_09840) | - | 2040708..2040881 (+) | 174 | WP_012679310.1 | hypothetical protein | - |
| JZI59_RS09845 (JZI59_09845) | - | 2041218..2041658 (+) | 441 | WP_012679312.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JZI59_RS09850 (JZI59_09850) | - | 2042056..2042433 (-) | 378 | WP_012679314.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| JZI59_RS09855 (JZI59_09855) | - | 2042485..2042670 (-) | 186 | WP_012679315.1 | type II toxin-antitoxin system HicA family toxin | - |
| JZI59_RS09860 (JZI59_09860) | - | 2042786..2043121 (+) | 336 | WP_012679316.1 | HNH endonuclease signature motif containing protein | - |
| JZI59_RS09865 (JZI59_09865) | - | 2043284..2043751 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| JZI59_RS09870 (JZI59_09870) | - | 2043766..2045520 (+) | 1755 | WP_012679317.1 | terminase TerL endonuclease subunit | - |
| JZI59_RS09875 (JZI59_09875) | - | 2045517..2045687 (+) | 171 | WP_012679318.1 | hypothetical protein | - |
| JZI59_RS09880 (JZI59_09880) | - | 2045680..2045946 (+) | 267 | WP_012679319.1 | hypothetical protein | - |
| JZI59_RS09885 (JZI59_09885) | - | 2045980..2047200 (+) | 1221 | WP_012679320.1 | phage portal protein | - |
| JZI59_RS09890 (JZI59_09890) | - | 2047178..2047843 (+) | 666 | WP_012679321.1 | head maturation protease, ClpP-related | - |
| JZI59_RS09895 (JZI59_09895) | - | 2047868..2049055 (+) | 1188 | WP_012679322.1 | phage major capsid protein | - |
| JZI59_RS11200 | - | 2049069..2049197 (+) | 129 | WP_012679323.1 | hypothetical protein | - |
| JZI59_RS09900 (JZI59_09900) | - | 2049200..2049502 (+) | 303 | WP_012679324.1 | head-tail connector protein | - |
| JZI59_RS09905 (JZI59_09905) | - | 2049499..2049846 (+) | 348 | WP_012679325.1 | phage head closure protein | - |
| JZI59_RS09910 (JZI59_09910) | - | 2049843..2050220 (+) | 378 | WP_012679326.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JZI59_RS09915 (JZI59_09915) | - | 2050217..2050642 (+) | 426 | WP_050315850.1 | hypothetical protein | - |
| JZI59_RS09920 (JZI59_09920) | - | 2050658..2051248 (+) | 591 | WP_012679328.1 | major tail protein | - |
| JZI59_RS09925 (JZI59_09925) | - | 2051300..2051626 (+) | 327 | WP_012679329.1 | hypothetical protein | - |
| JZI59_RS09930 (JZI59_09930) | - | 2051674..2051823 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| JZI59_RS09935 (JZI59_09935) | - | 2051836..2055495 (+) | 3660 | WP_050315849.1 | phage tail tape measure protein | - |
| JZI59_RS09940 (JZI59_09940) | - | 2055495..2056202 (+) | 708 | WP_012679331.1 | distal tail protein Dit | - |
| JZI59_RS09945 (JZI59_09945) | - | 2056199..2058340 (+) | 2142 | WP_012679332.1 | phage tail spike protein | - |
| JZI59_RS09950 (JZI59_09950) | - | 2058340..2059101 (+) | 762 | WP_012679333.1 | collagen-like protein | - |
| JZI59_RS09955 (JZI59_09955) | - | 2059103..2059720 (+) | 618 | WP_012679334.1 | hypothetical protein | - |
| JZI59_RS09960 (JZI59_09960) | - | 2059731..2061614 (+) | 1884 | WP_012679335.1 | gp58-like family protein | - |
| JZI59_RS09965 (JZI59_09965) | - | 2061623..2062054 (+) | 432 | WP_012679336.1 | DUF1617 family protein | - |
| JZI59_RS09970 (JZI59_09970) | - | 2062057..2062671 (+) | 615 | WP_012679337.1 | DUF1366 domain-containing protein | - |
| JZI59_RS09975 (JZI59_09975) | - | 2062684..2062974 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI59_RS09980 (JZI59_09980) | - | 2062977..2063156 (+) | 180 | WP_012679339.1 | holin | - |
| JZI59_RS09985 (JZI59_09985) | - | 2063268..2064464 (+) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| JZI59_RS09990 (JZI59_09990) | - | 2064599..2065141 (+) | 543 | WP_012679342.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| JZI59_RS09995 (JZI59_09995) | - | 2065145..2065981 (+) | 837 | WP_012679343.1 | hypothetical protein | - |
| JZI59_RS10000 (JZI59_10000) | - | 2066353..2066928 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| JZI59_RS11120 | - | 2066922..2067209 (+) | 288 | WP_011106694.1 | hypothetical protein | - |
| JZI59_RS10005 (JZI59_10005) | prx | 2067277..2067459 (+) | 183 | WP_012679346.1 | hypothetical protein | Regulator |
| JZI59_RS10010 (JZI59_10010) | - | 2067651..2068046 (+) | 396 | WP_228275436.1 | DUF5590 domain-containing protein | - |
| JZI59_RS10015 (JZI59_10015) | - | 2068043..2069254 (+) | 1212 | WP_012679347.1 | pyridoxal phosphate-dependent aminotransferase | - |
| JZI59_RS10020 (JZI59_10020) | asnS | 2069267..2070613 (+) | 1347 | WP_012679348.1 | asparagine--tRNA ligase | - |
| JZI59_RS10025 (JZI59_10025) | - | 2070915..2072009 (+) | 1095 | WP_012679349.1 | LPXTG cell wall anchor domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6943.77 Da Isoelectric Point: 4.1677
>NTDB_id=543140 JZI59_RS10005 WP_012679346.1 2067277..2067459(+) (prx) [Streptococcus equi subsp. equi strain 470_008]
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVRNGEVVTDEKVEEVMRELDK
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVRNGEVVTDEKVEEVMRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=543140 JZI59_RS10005 WP_012679346.1 2067277..2067459(+) (prx) [Streptococcus equi subsp. equi strain 470_008]
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTAAGGAACGGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTAAGGAACGGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |