Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI59_RS03375 | Genome accession | NZ_CP071144 |
| Coordinates | 732486..732671 (-) | Length | 61 a.a. |
| NCBI ID | WP_012679954.1 | Uniprot ID | C0M6G1 |
| Organism | Streptococcus equi subsp. equi strain 470_008 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 732486..763268 | 732486..732671 | within | 0 |
Gene organization within MGE regions
Location: 732486..763268
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI59_RS03375 (JZI59_03375) | prx | 732486..732671 (-) | 186 | WP_012679954.1 | hypothetical protein | Regulator |
| JZI59_RS03380 (JZI59_03380) | spel | 732793..733581 (-) | 789 | WP_012679955.1 | streptococcal pyrogenic exotoxin SpeL | - |
| JZI59_RS03385 (JZI59_03385) | spek | 733848..734627 (-) | 780 | WP_050316071.1 | streptococcal pyrogenic exotoxin SpeK | - |
| JZI59_RS03390 (JZI59_03390) | - | 734752..735981 (-) | 1230 | WP_012679957.1 | glucosaminidase domain-containing protein | - |
| JZI59_RS03395 (JZI59_03395) | - | 736093..736272 (-) | 180 | WP_012679339.1 | holin | - |
| JZI59_RS03400 (JZI59_03400) | - | 736275..736565 (-) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI59_RS03405 (JZI59_03405) | - | 736578..737192 (-) | 615 | WP_012679958.1 | DUF1366 domain-containing protein | - |
| JZI59_RS03410 (JZI59_03410) | - | 737195..737626 (-) | 432 | WP_012679959.1 | DUF1617 family protein | - |
| JZI59_RS03415 (JZI59_03415) | - | 737635..739539 (-) | 1905 | WP_012679960.1 | gp58-like family protein | - |
| JZI59_RS03420 (JZI59_03420) | - | 739550..740164 (-) | 615 | WP_012679961.1 | hypothetical protein | - |
| JZI59_RS03425 (JZI59_03425) | - | 740166..740873 (-) | 708 | WP_012679962.1 | collagen-like protein | - |
| JZI59_RS03430 (JZI59_03430) | - | 740873..742930 (-) | 2058 | WP_050316055.1 | phage tail spike protein | - |
| JZI59_RS03435 (JZI59_03435) | - | 742927..743706 (-) | 780 | WP_012679964.1 | distal tail protein Dit | - |
| JZI59_RS03440 (JZI59_03440) | - | 743738..746992 (-) | 3255 | WP_012679965.1 | tape measure protein | - |
| JZI59_RS03445 (JZI59_03445) | - | 747009..747272 (-) | 264 | WP_230197369.1 | hypothetical protein | - |
| JZI59_RS03450 (JZI59_03450) | - | 747380..747739 (-) | 360 | WP_012679967.1 | tail assembly chaperone | - |
| JZI59_RS03455 (JZI59_03455) | - | 747801..748326 (-) | 526 | Protein_685 | phage major tail protein, TP901-1 family | - |
| JZI59_RS03460 (JZI59_03460) | - | 748402..748791 (-) | 390 | WP_012679970.1 | hypothetical protein | - |
| JZI59_RS03465 (JZI59_03465) | - | 748788..749153 (-) | 366 | WP_012679971.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JZI59_RS03470 (JZI59_03470) | - | 749134..749442 (-) | 309 | WP_012679972.1 | hypothetical protein | - |
| JZI59_RS03475 (JZI59_03475) | - | 749439..749792 (-) | 354 | WP_012679973.1 | phage head-tail connector protein | - |
| JZI59_RS03480 (JZI59_03480) | - | 749802..750068 (-) | 267 | WP_012679974.1 | HeH/LEM domain-containing protein | - |
| JZI59_RS03485 (JZI59_03485) | - | 750079..751128 (-) | 1050 | WP_012679975.1 | major capsid protein | - |
| JZI59_RS03490 (JZI59_03490) | - | 751131..751511 (-) | 381 | WP_012679976.1 | head decoration protein | - |
| JZI59_RS03495 (JZI59_03495) | - | 751522..752145 (-) | 624 | WP_042357153.1 | DUF4355 domain-containing protein | - |
| JZI59_RS03500 (JZI59_03500) | - | 752327..752494 (-) | 168 | WP_012679978.1 | hypothetical protein | - |
| JZI59_RS03505 (JZI59_03505) | - | 752530..752799 (-) | 270 | WP_012679979.1 | hypothetical protein | - |
| JZI59_RS03510 (JZI59_03510) | - | 752996..753415 (-) | 420 | WP_012679981.1 | HD domain-containing protein | - |
| JZI59_RS03515 (JZI59_03515) | - | 753412..753618 (-) | 207 | WP_003052398.1 | hypothetical protein | - |
| JZI59_RS03520 (JZI59_03520) | - | 753620..755197 (-) | 1578 | WP_042357165.1 | phage head morphogenesis protein | - |
| JZI59_RS03525 (JZI59_03525) | - | 755178..756680 (-) | 1503 | WP_050316050.1 | phage portal protein | - |
| JZI59_RS03530 (JZI59_03530) | - | 756692..757939 (-) | 1248 | WP_012679984.1 | PBSX family phage terminase large subunit | - |
| JZI59_RS03540 (JZI59_03540) | - | 759531..760319 (+) | 789 | WP_012679985.1 | helix-turn-helix transcriptional regulator | - |
| JZI59_RS03545 (JZI59_03545) | - | 760328..761497 (+) | 1170 | WP_012679986.1 | DUF4041 domain-containing protein | - |
| JZI59_RS03550 (JZI59_03550) | - | 761500..761703 (+) | 204 | WP_012679987.1 | hypothetical protein | - |
| JZI59_RS03555 (JZI59_03555) | - | 761835..763268 (+) | 1434 | WP_012679988.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6981.00 Da Isoelectric Point: 3.8428
>NTDB_id=543097 JZI59_RS03375 WP_012679954.1 732486..732671(-) (prx) [Streptococcus equi subsp. equi strain 470_008]
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
Nucleotide
Download Length: 186 bp
>NTDB_id=543097 JZI59_RS03375 WP_012679954.1 732486..732671(-) (prx) [Streptococcus equi subsp. equi strain 470_008]
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
95.082 |
0.705 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS8232 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
95.082 |
0.639 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
68.852 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
67.213 |
0.557 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
67.213 |
0.475 |