Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JZI57_RS05870 | Genome accession | NZ_CP071142 |
| Coordinates | 1179130..1179315 (+) | Length | 61 a.a. |
| NCBI ID | WP_012679954.1 | Uniprot ID | C0M6G1 |
| Organism | Streptococcus equi subsp. equi strain 489_004 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1148533..1179315 | 1179130..1179315 | within | 0 |
Gene organization within MGE regions
Location: 1148533..1179315
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZI57_RS05690 (JZI57_05690) | - | 1148533..1149966 (-) | 1434 | WP_012679988.1 | recombinase family protein | - |
| JZI57_RS05695 (JZI57_05695) | - | 1150098..1150301 (-) | 204 | WP_012679987.1 | hypothetical protein | - |
| JZI57_RS05700 (JZI57_05700) | - | 1150304..1151473 (-) | 1170 | WP_012679986.1 | DUF4041 domain-containing protein | - |
| JZI57_RS05705 (JZI57_05705) | - | 1151482..1152270 (-) | 789 | WP_012679985.1 | helix-turn-helix transcriptional regulator | - |
| JZI57_RS05710 (JZI57_05710) | - | 1152502..1153844 (+) | 1343 | WP_165626751.1 | IS3 family transposase | - |
| JZI57_RS05715 (JZI57_05715) | - | 1153862..1155109 (+) | 1248 | WP_012679984.1 | PBSX family phage terminase large subunit | - |
| JZI57_RS05720 (JZI57_05720) | - | 1155121..1156623 (+) | 1503 | WP_050316050.1 | phage portal protein | - |
| JZI57_RS05725 (JZI57_05725) | - | 1156604..1158181 (+) | 1578 | WP_042357165.1 | phage head morphogenesis protein | - |
| JZI57_RS05730 (JZI57_05730) | - | 1158183..1158389 (+) | 207 | WP_003052398.1 | hypothetical protein | - |
| JZI57_RS05735 (JZI57_05735) | - | 1158386..1158805 (+) | 420 | WP_012679981.1 | HD domain-containing protein | - |
| JZI57_RS05740 (JZI57_05740) | - | 1159002..1159271 (+) | 270 | WP_012679979.1 | hypothetical protein | - |
| JZI57_RS05745 (JZI57_05745) | - | 1159307..1159474 (+) | 168 | WP_012679978.1 | hypothetical protein | - |
| JZI57_RS05750 (JZI57_05750) | - | 1159656..1160279 (+) | 624 | WP_042357153.1 | DUF4355 domain-containing protein | - |
| JZI57_RS05755 (JZI57_05755) | - | 1160290..1160670 (+) | 381 | WP_012679976.1 | head decoration protein | - |
| JZI57_RS05760 (JZI57_05760) | - | 1160673..1161722 (+) | 1050 | WP_012679975.1 | major capsid protein | - |
| JZI57_RS05765 (JZI57_05765) | - | 1161733..1161999 (+) | 267 | WP_012679974.1 | HeH/LEM domain-containing protein | - |
| JZI57_RS05770 (JZI57_05770) | - | 1162009..1162362 (+) | 354 | WP_012679973.1 | phage head-tail connector protein | - |
| JZI57_RS05775 (JZI57_05775) | - | 1162359..1162667 (+) | 309 | WP_012679972.1 | hypothetical protein | - |
| JZI57_RS05780 (JZI57_05780) | - | 1162648..1163013 (+) | 366 | WP_012679971.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JZI57_RS05785 (JZI57_05785) | - | 1163010..1163399 (+) | 390 | WP_012679970.1 | hypothetical protein | - |
| JZI57_RS05790 (JZI57_05790) | - | 1163475..1164000 (+) | 526 | Protein_1097 | phage major tail protein, TP901-1 family | - |
| JZI57_RS05795 (JZI57_05795) | - | 1164062..1164421 (+) | 360 | WP_012679967.1 | tail assembly chaperone | - |
| JZI57_RS05800 (JZI57_05800) | - | 1164496..1164792 (+) | 297 | WP_230197423.1 | hypothetical protein | - |
| JZI57_RS05805 (JZI57_05805) | - | 1164809..1168063 (+) | 3255 | WP_012679965.1 | tape measure protein | - |
| JZI57_RS05810 (JZI57_05810) | - | 1168095..1168874 (+) | 780 | WP_012679964.1 | distal tail protein Dit | - |
| JZI57_RS05815 (JZI57_05815) | - | 1168871..1170928 (+) | 2058 | WP_050316055.1 | phage tail spike protein | - |
| JZI57_RS05820 (JZI57_05820) | - | 1170928..1171635 (+) | 708 | WP_012679962.1 | collagen-like protein | - |
| JZI57_RS05825 (JZI57_05825) | - | 1171637..1172251 (+) | 615 | WP_012679961.1 | hypothetical protein | - |
| JZI57_RS05830 (JZI57_05830) | - | 1172262..1174166 (+) | 1905 | WP_012679960.1 | gp58-like family protein | - |
| JZI57_RS05835 (JZI57_05835) | - | 1174175..1174606 (+) | 432 | WP_012679959.1 | DUF1617 family protein | - |
| JZI57_RS05840 (JZI57_05840) | - | 1174609..1175223 (+) | 615 | WP_012679958.1 | DUF1366 domain-containing protein | - |
| JZI57_RS05845 (JZI57_05845) | - | 1175236..1175526 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| JZI57_RS05850 (JZI57_05850) | - | 1175529..1175708 (+) | 180 | WP_012679339.1 | holin | - |
| JZI57_RS05855 (JZI57_05855) | - | 1175820..1177049 (+) | 1230 | WP_012679957.1 | glucosaminidase domain-containing protein | - |
| JZI57_RS05860 (JZI57_05860) | spek | 1177174..1177953 (+) | 780 | WP_050316071.1 | streptococcal pyrogenic exotoxin SpeK | - |
| JZI57_RS05865 (JZI57_05865) | spel | 1178220..1179008 (+) | 789 | WP_012679955.1 | streptococcal pyrogenic exotoxin SpeL | - |
| JZI57_RS05870 (JZI57_05870) | prx | 1179130..1179315 (+) | 186 | WP_012679954.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6981.00 Da Isoelectric Point: 3.8428
>NTDB_id=543060 JZI57_RS05870 WP_012679954.1 1179130..1179315(+) (prx) [Streptococcus equi subsp. equi strain 489_004]
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
Nucleotide
Download Length: 186 bp
>NTDB_id=543060 JZI57_RS05870 WP_012679954.1 1179130..1179315(+) (prx) [Streptococcus equi subsp. equi strain 489_004]
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
95.082 |
0.705 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS8232 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
95.082 |
0.639 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
68.852 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
67.213 |
0.557 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
67.213 |
0.475 |