Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | A20_RS07015 | Genome accession | NC_018936 |
| Coordinates | 1385365..1385544 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes A20 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1385365..1425981 | 1385365..1385544 | within | 0 |
Gene organization within MGE regions
Location: 1385365..1425981
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A20_RS07015 (A20_1462c) | prx | 1385365..1385544 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| A20_RS07020 (A20_1463) | sda1 | 1385783..1386955 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| A20_RS07025 (A20_1464c) | - | 1387071..1388267 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| A20_RS07035 (A20_1465c) | - | 1388378..1388563 (-) | 186 | WP_002988802.1 | holin | - |
| A20_RS07040 (A20_1466c) | - | 1388560..1388859 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| A20_RS07045 (A20_1467c) | - | 1388870..1389490 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| A20_RS09545 (A20_1468c) | - | 1389493..1389654 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| A20_RS07050 (A20_1469c) | - | 1389663..1391570 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| A20_RS07055 (A20_1470c) | - | 1391581..1392216 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| A20_RS07060 (A20_1471c) | - | 1392216..1393271 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| A20_RS07065 (A20_1472c) | - | 1393268..1395250 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| A20_RS07070 (A20_1473c) | - | 1395260..1396102 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| A20_RS07075 (A20_1474c) | - | 1396114..1400496 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| A20_RS07080 (A20_1475c) | - | 1400511..1400744 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| A20_RS07085 (A20_1476c) | - | 1400819..1401274 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| A20_RS07090 (A20_1477c) | - | 1401328..1401927 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| A20_RS07095 (A20_1478c) | - | 1401939..1402298 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| A20_RS07100 | - | 1402302..1402646 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| A20_RS07105 (A20_1480c) | - | 1402643..1402921 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| A20_RS07110 (A20_1481c) | - | 1402932..1403288 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| A20_RS07115 (A20_1482c) | - | 1403300..1404187 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| A20_RS07120 (A20_1483c) | - | 1404200..1404769 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| A20_RS07125 (A20_1484c) | - | 1404925..1405191 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| A20_RS07130 | - | 1405194..1405382 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| A20_RS07135 (A20_1486c) | - | 1405413..1406858 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| A20_RS07140 (A20_1487c) | - | 1406818..1408350 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| A20_RS07145 (A20_1488c) | - | 1408366..1409643 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| A20_RS07150 (A20_1489c) | - | 1409633..1410085 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| A20_RS07155 (A20_1490c) | - | 1410175..1410591 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| A20_RS07160 (A20_1491c) | - | 1410588..1410779 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| A20_RS07165 (A20_1492c) | - | 1410769..1411620 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| A20_RS07170 | - | 1411629..1411895 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| A20_RS09865 (A20_1494c) | - | 1411892..1412059 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| A20_RS07175 (A20_1495c) | - | 1412060..1413382 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| A20_RS07180 (A20_1496c) | - | 1413379..1413654 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| A20_RS07185 (A20_1497c) | - | 1414041..1416425 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| A20_RS07190 (A20_1498c) | - | 1416430..1418352 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| A20_RS07195 (A20_1499c) | - | 1418395..1418952 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| A20_RS07200 (A20_1500c) | - | 1418963..1419361 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| A20_RS07205 (A20_1501c) | - | 1419365..1420519 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| A20_RS07210 (A20_1502c) | - | 1420519..1420818 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| A20_RS07215 (A20_1503c) | - | 1420906..1421109 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| A20_RS07220 (A20_1505c) | - | 1421255..1421641 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| A20_RS07225 (A20_1506c) | - | 1421638..1421841 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| A20_RS09550 (A20_1507c) | - | 1421834..1422004 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| A20_RS07230 (A20_1508c) | - | 1422001..1422276 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| A20_RS07235 (A20_1509c) | - | 1422338..1422553 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| A20_RS07240 (A20_1510) | - | 1422601..1423014 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| A20_RS09870 (A20_1511c) | - | 1422995..1423150 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| A20_RS07245 (A20_1512) | - | 1423476..1423826 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| A20_RS07250 (A20_1513) | - | 1423840..1424223 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A20_RS07255 (A20_1514) | - | 1424234..1424785 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| A20_RS07260 (A20_1515) | - | 1424902..1425981 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=54207 A20_RS07015 WP_002988813.1 1385365..1385544(-) (prx) [Streptococcus pyogenes A20]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=54207 A20_RS07015 WP_002988813.1 1385365..1385544(-) (prx) [Streptococcus pyogenes A20]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |