Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JYQ80_RS07045 | Genome accession | NZ_CP070994 |
| Coordinates | 1402563..1402742 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain M11318 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1394681..1443180 | 1402563..1402742 | within | 0 |
Gene organization within MGE regions
Location: 1394681..1443180
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JYQ80_RS07005 (JYQ80_07005) | - | 1394681..1395115 (-) | 435 | WP_010922579.1 | CopY/TcrY family copper transport repressor | - |
| JYQ80_RS07010 (JYQ80_07010) | - | 1395299..1396273 (+) | 975 | WP_227869327.1 | alpha/beta hydrolase fold domain-containing protein | - |
| JYQ80_RS07015 (JYQ80_07015) | rbfA | 1396407..1396757 (-) | 351 | WP_002994317.1 | 30S ribosome-binding factor RbfA | - |
| JYQ80_RS07020 (JYQ80_07020) | infB | 1396962..1399823 (-) | 2862 | WP_002983491.1 | translation initiation factor IF-2 | - |
| JYQ80_RS07025 (JYQ80_07025) | - | 1399843..1400145 (-) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| JYQ80_RS07030 (JYQ80_07030) | rnpM | 1400138..1400434 (-) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| JYQ80_RS07035 (JYQ80_07035) | nusA | 1400450..1401607 (-) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| JYQ80_RS07040 (JYQ80_07040) | rimP | 1401782..1402318 (-) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| JYQ80_RS07045 (JYQ80_07045) | prx | 1402563..1402742 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| JYQ80_RS07050 (JYQ80_07050) | sda1 | 1402981..1404153 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| JYQ80_RS07055 (JYQ80_07055) | - | 1404269..1405465 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| JYQ80_RS07060 (JYQ80_07060) | - | 1405576..1405761 (-) | 186 | WP_002988802.1 | holin | - |
| JYQ80_RS07065 (JYQ80_07065) | - | 1405758..1406057 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| JYQ80_RS07070 (JYQ80_07070) | - | 1406068..1406688 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| JYQ80_RS07075 (JYQ80_07075) | - | 1406691..1406852 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| JYQ80_RS07080 (JYQ80_07080) | - | 1406861..1408768 (-) | 1908 | WP_206285685.1 | gp58-like family protein | - |
| JYQ80_RS07085 (JYQ80_07085) | - | 1408779..1409414 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| JYQ80_RS07090 (JYQ80_07090) | - | 1409414..1410469 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| JYQ80_RS07095 (JYQ80_07095) | - | 1410466..1412448 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| JYQ80_RS07100 (JYQ80_07100) | - | 1412458..1413300 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| JYQ80_RS07105 (JYQ80_07105) | - | 1413312..1417694 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| JYQ80_RS07110 (JYQ80_07110) | - | 1417709..1417942 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| JYQ80_RS07115 (JYQ80_07115) | - | 1418017..1418472 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| JYQ80_RS07120 (JYQ80_07120) | - | 1418526..1419125 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| JYQ80_RS07125 (JYQ80_07125) | - | 1419137..1419496 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| JYQ80_RS07130 (JYQ80_07130) | - | 1419500..1419844 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JYQ80_RS07135 (JYQ80_07135) | - | 1419841..1420119 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| JYQ80_RS07140 (JYQ80_07140) | - | 1420130..1420486 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| JYQ80_RS07145 (JYQ80_07145) | - | 1420498..1421385 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| JYQ80_RS07150 (JYQ80_07150) | - | 1421398..1421967 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| JYQ80_RS07155 (JYQ80_07155) | - | 1422048..1422389 (-) | 342 | WP_241007341.1 | hypothetical protein | - |
| JYQ80_RS07160 (JYQ80_07160) | - | 1422392..1422580 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| JYQ80_RS07165 (JYQ80_07165) | - | 1422611..1424056 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| JYQ80_RS07170 (JYQ80_07170) | - | 1424016..1425548 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| JYQ80_RS07175 (JYQ80_07175) | - | 1425564..1426842 (-) | 1279 | Protein_1385 | PBSX family phage terminase large subunit | - |
| JYQ80_RS07180 (JYQ80_07180) | - | 1426832..1427284 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| JYQ80_RS07185 (JYQ80_07185) | - | 1427374..1427790 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| JYQ80_RS07190 (JYQ80_07190) | - | 1427787..1427978 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| JYQ80_RS07195 (JYQ80_07195) | - | 1427968..1428819 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| JYQ80_RS07200 (JYQ80_07200) | - | 1428828..1429094 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| JYQ80_RS07205 (JYQ80_07205) | - | 1429091..1429258 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| JYQ80_RS07210 (JYQ80_07210) | - | 1429259..1430581 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| JYQ80_RS07215 (JYQ80_07215) | - | 1430578..1430853 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| JYQ80_RS07220 (JYQ80_07220) | - | 1431240..1433624 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| JYQ80_RS07225 (JYQ80_07225) | - | 1433629..1435551 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| JYQ80_RS07230 (JYQ80_07230) | - | 1435594..1436151 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| JYQ80_RS07235 (JYQ80_07235) | - | 1436162..1436560 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| JYQ80_RS07240 (JYQ80_07240) | - | 1436564..1437718 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| JYQ80_RS07245 (JYQ80_07245) | - | 1437718..1438017 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| JYQ80_RS07250 (JYQ80_07250) | - | 1438105..1438308 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| JYQ80_RS07255 (JYQ80_07255) | - | 1438454..1438840 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| JYQ80_RS07260 (JYQ80_07260) | - | 1438837..1439040 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| JYQ80_RS07265 (JYQ80_07265) | - | 1439033..1439203 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| JYQ80_RS07270 (JYQ80_07270) | - | 1439200..1439475 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| JYQ80_RS07275 (JYQ80_07275) | - | 1439537..1439752 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| JYQ80_RS07280 (JYQ80_07280) | - | 1439800..1440213 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| JYQ80_RS07285 (JYQ80_07285) | - | 1440194..1440349 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| JYQ80_RS07290 (JYQ80_07290) | - | 1440675..1441025 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| JYQ80_RS07295 (JYQ80_07295) | - | 1441039..1441422 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JYQ80_RS07300 (JYQ80_07300) | - | 1441433..1441984 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| JYQ80_RS07305 (JYQ80_07305) | - | 1442101..1443180 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=542035 JYQ80_RS07045 WP_002988813.1 1402563..1402742(-) (prx) [Streptococcus pyogenes strain M11318]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=542035 JYQ80_RS07045 WP_002988813.1 1402563..1402742(-) (prx) [Streptococcus pyogenes strain M11318]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |