Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | JYQ80_RS05780 | Genome accession | NZ_CP070994 |
| Coordinates | 1162886..1163068 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain M11318 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1162886..1196372 | 1162886..1163068 | within | 0 |
Gene organization within MGE regions
Location: 1162886..1196372
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JYQ80_RS05780 (JYQ80_05780) | prx | 1162886..1163068 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| JYQ80_RS05785 (JYQ80_05785) | sda3 | 1163307..1164107 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| JYQ80_RS05790 (JYQ80_05790) | - | 1164378..1164812 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| JYQ80_RS05795 (JYQ80_05795) | - | 1164882..1166087 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| JYQ80_RS05800 (JYQ80_05800) | - | 1166203..1166430 (-) | 228 | WP_003058873.1 | phage holin | - |
| JYQ80_RS05805 (JYQ80_05805) | - | 1166427..1166702 (-) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| JYQ80_RS05810 (JYQ80_05810) | - | 1166712..1167329 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| JYQ80_RS05815 (JYQ80_05815) | - | 1167326..1167763 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| JYQ80_RS05820 (JYQ80_05820) | - | 1167775..1169391 (-) | 1617 | WP_015446227.1 | gp58-like family protein | - |
| JYQ80_RS09345 | - | 1169398..1169643 (-) | 246 | Protein_1126 | phage tail spike protein | - |
| JYQ80_RS05825 (JYQ80_05825) | - | 1169640..1170335 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| JYQ80_RS05830 (JYQ80_05830) | - | 1170332..1172689 (-) | 2358 | WP_010922453.1 | phage tail protein | - |
| JYQ80_RS05835 (JYQ80_05835) | - | 1172689..1173060 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| JYQ80_RS05840 (JYQ80_05840) | - | 1173075..1173338 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| JYQ80_RS05845 (JYQ80_05845) | - | 1173349..1173942 (-) | 594 | WP_010922456.1 | tail protein | - |
| JYQ80_RS05850 (JYQ80_05850) | - | 1173954..1174289 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| JYQ80_RS05855 (JYQ80_05855) | - | 1174290..1174526 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| JYQ80_RS05860 (JYQ80_05860) | - | 1174519..1174857 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| JYQ80_RS05865 (JYQ80_05865) | - | 1174817..1175239 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| JYQ80_RS05870 (JYQ80_05870) | - | 1175249..1175449 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| JYQ80_RS05875 (JYQ80_05875) | - | 1175449..1176360 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| JYQ80_RS05880 (JYQ80_05880) | - | 1176385..1176846 (-) | 462 | WP_011285618.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| JYQ80_RS05885 (JYQ80_05885) | - | 1176927..1178342 (-) | 1416 | WP_011285619.1 | terminase | - |
| JYQ80_RS05890 (JYQ80_05890) | - | 1178452..1178718 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| JYQ80_RS05895 (JYQ80_05895) | - | 1178711..1178890 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| JYQ80_RS05900 (JYQ80_05900) | - | 1178940..1179164 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| JYQ80_RS05905 (JYQ80_05905) | - | 1179170..1180663 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| JYQ80_RS05910 (JYQ80_05910) | - | 1180656..1181924 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| JYQ80_RS05915 (JYQ80_05915) | - | 1181921..1182277 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| JYQ80_RS05920 (JYQ80_05920) | - | 1182426..1182770 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| JYQ80_RS05925 (JYQ80_05925) | - | 1182879..1183298 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| JYQ80_RS05930 (JYQ80_05930) | - | 1183566..1184201 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| JYQ80_RS05935 (JYQ80_05935) | - | 1184203..1184472 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| JYQ80_RS05940 (JYQ80_05940) | - | 1184556..1185068 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| JYQ80_RS05945 (JYQ80_05945) | - | 1185065..1185406 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| JYQ80_RS05950 (JYQ80_05950) | - | 1185584..1185751 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| JYQ80_RS05955 (JYQ80_05955) | - | 1185761..1186558 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| JYQ80_RS05960 (JYQ80_05960) | - | 1186555..1187484 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| JYQ80_RS05965 (JYQ80_05965) | - | 1187487..1187816 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| JYQ80_RS05970 (JYQ80_05970) | - | 1187872..1188078 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| JYQ80_RS05975 (JYQ80_05975) | - | 1188087..1188227 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| JYQ80_RS05980 (JYQ80_05980) | - | 1188224..1188457 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| JYQ80_RS05985 (JYQ80_05985) | - | 1188438..1188827 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| JYQ80_RS09190 | - | 1188972..1189211 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| JYQ80_RS05990 (JYQ80_05990) | - | 1189311..1189496 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| JYQ80_RS05995 (JYQ80_05995) | - | 1189498..1189809 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| JYQ80_RS06000 (JYQ80_06000) | - | 1189887..1190072 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| JYQ80_RS06005 (JYQ80_06005) | - | 1190239..1190478 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| JYQ80_RS06010 (JYQ80_06010) | - | 1190620..1191426 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| JYQ80_RS06015 (JYQ80_06015) | - | 1191361..1191627 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| JYQ80_RS06020 (JYQ80_06020) | - | 1191659..1192375 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| JYQ80_RS06025 (JYQ80_06025) | - | 1192387..1192578 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| JYQ80_RS06030 (JYQ80_06030) | - | 1193214..1193309 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| JYQ80_RS06035 (JYQ80_06035) | - | 1193732..1194079 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| JYQ80_RS06040 (JYQ80_06040) | - | 1194083..1194463 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JYQ80_RS06045 (JYQ80_06045) | - | 1194475..1194741 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| JYQ80_RS06050 (JYQ80_06050) | - | 1194865..1196007 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| JYQ80_RS06055 (JYQ80_06055) | - | 1196097..1196372 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=542028 JYQ80_RS05780 WP_011017964.1 1162886..1163068(-) (prx) [Streptococcus pyogenes strain M11318]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=542028 JYQ80_RS05780 WP_011017964.1 1162886..1163068(-) (prx) [Streptococcus pyogenes strain M11318]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |