Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | JYQ80_RS04965 | Genome accession | NZ_CP070994 |
| Coordinates | 1001145..1001333 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain M11318 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 993561..1039871 | 1001145..1001333 | within | 0 |
Gene organization within MGE regions
Location: 993561..1039871
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JYQ80_RS04930 (JYQ80_04930) | pfkA | 993561..994574 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| JYQ80_RS04935 (JYQ80_04935) | - | 994654..997764 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| JYQ80_RS04940 (JYQ80_04940) | - | 997949..998320 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| JYQ80_RS04945 (JYQ80_04945) | - | 998320..999018 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| JYQ80_RS04950 (JYQ80_04950) | - | 999028..999813 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| JYQ80_RS04955 (JYQ80_04955) | - | 999940..1000554 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| JYQ80_RS04965 (JYQ80_04965) | prx | 1001145..1001333 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| JYQ80_RS04970 (JYQ80_04970) | speA | 1001553..1002308 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| JYQ80_RS04975 (JYQ80_04975) | - | 1002430..1003089 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| JYQ80_RS04980 (JYQ80_04980) | - | 1003089..1003310 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| JYQ80_RS04985 (JYQ80_04985) | - | 1003320..1004093 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| JYQ80_RS04990 (JYQ80_04990) | - | 1004104..1004706 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| JYQ80_RS04995 (JYQ80_04995) | - | 1004718..1005482 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| JYQ80_RS05000 (JYQ80_05000) | - | 1005484..1005816 (-) | 333 | WP_011285562.1 | phage holin | - |
| JYQ80_RS05005 (JYQ80_05005) | - | 1005816..1006139 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| JYQ80_RS09250 | - | 1006153..1006275 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| JYQ80_RS05010 (JYQ80_05010) | - | 1006289..1006636 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| JYQ80_RS05015 (JYQ80_05015) | - | 1006647..1008509 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| JYQ80_RS05020 (JYQ80_05020) | - | 1008514..1011954 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| JYQ80_RS05025 (JYQ80_05025) | - | 1011955..1013439 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| JYQ80_RS05030 (JYQ80_05030) | - | 1013440..1015245 (-) | 1806 | WP_011054802.1 | phage tail protein | - |
| JYQ80_RS05035 (JYQ80_05035) | - | 1015238..1015696 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| JYQ80_RS05040 (JYQ80_05040) | - | 1015669..1015986 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| JYQ80_RS05045 (JYQ80_05045) | - | 1015999..1016505 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| JYQ80_RS05050 (JYQ80_05050) | - | 1016517..1016927 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| JYQ80_RS05055 (JYQ80_05055) | - | 1016929..1017324 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| JYQ80_RS05060 (JYQ80_05060) | - | 1017321..1017632 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| JYQ80_RS05065 (JYQ80_05065) | - | 1017629..1017973 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| JYQ80_RS05070 (JYQ80_05070) | - | 1017987..1018280 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| JYQ80_RS05075 (JYQ80_05075) | - | 1018293..1019183 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| JYQ80_RS05080 (JYQ80_05080) | - | 1019202..1019771 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| JYQ80_RS09255 | - | 1019880..1020014 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| JYQ80_RS05085 (JYQ80_05085) | - | 1020016..1020285 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| JYQ80_RS05090 (JYQ80_05090) | - | 1020292..1021200 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| JYQ80_RS05095 (JYQ80_05095) | - | 1021169..1022494 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| JYQ80_RS05100 (JYQ80_05100) | - | 1022494..1023768 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| JYQ80_RS05105 (JYQ80_05105) | - | 1023758..1024138 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| JYQ80_RS05110 (JYQ80_05110) | - | 1024748..1025182 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JYQ80_RS05115 (JYQ80_05115) | - | 1025468..1025734 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| JYQ80_RS05120 (JYQ80_05120) | - | 1025731..1026255 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| JYQ80_RS05125 (JYQ80_05125) | - | 1026258..1026890 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| JYQ80_RS05130 (JYQ80_05130) | - | 1026892..1027176 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| JYQ80_RS05135 (JYQ80_05135) | - | 1027173..1027343 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| JYQ80_RS05140 (JYQ80_05140) | - | 1027340..1027576 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| JYQ80_RS09290 | - | 1027576..1027821 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| JYQ80_RS05145 (JYQ80_05145) | - | 1027818..1028174 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| JYQ80_RS05150 (JYQ80_05150) | - | 1028171..1028611 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JYQ80_RS05155 (JYQ80_05155) | - | 1028611..1028814 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| JYQ80_RS05160 (JYQ80_05160) | ssb | 1028820..1029245 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| JYQ80_RS05165 (JYQ80_05165) | - | 1029238..1029912 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| JYQ80_RS05170 (JYQ80_05170) | - | 1029913..1030395 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| JYQ80_RS05175 (JYQ80_05175) | - | 1030417..1030671 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| JYQ80_RS05180 (JYQ80_05180) | - | 1030652..1031005 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| JYQ80_RS05185 (JYQ80_05185) | - | 1031146..1031928 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| JYQ80_RS05190 (JYQ80_05190) | - | 1031915..1032745 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| JYQ80_RS09175 | - | 1032759..1032947 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| JYQ80_RS09180 | - | 1033181..1033420 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| JYQ80_RS05200 (JYQ80_05200) | - | 1033551..1033760 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| JYQ80_RS05205 (JYQ80_05205) | - | 1033870..1034070 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| JYQ80_RS05210 (JYQ80_05210) | - | 1034144..1034530 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| JYQ80_RS05215 (JYQ80_05215) | - | 1034519..1034728 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| JYQ80_RS05220 (JYQ80_05220) | - | 1034782..1035381 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| JYQ80_RS05225 (JYQ80_05225) | - | 1035411..1035569 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| JYQ80_RS05230 (JYQ80_05230) | - | 1035926..1036750 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| JYQ80_RS05235 (JYQ80_05235) | - | 1036786..1037679 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| JYQ80_RS05240 (JYQ80_05240) | - | 1037800..1038888 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| JYQ80_RS05245 (JYQ80_05245) | - | 1039251..1039871 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=542024 JYQ80_RS04965 WP_011285559.1 1001145..1001333(-) (prx) [Streptococcus pyogenes strain M11318]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=542024 JYQ80_RS04965 WP_011285559.1 1001145..1001333(-) (prx) [Streptococcus pyogenes strain M11318]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |